KEGG   Clostridium thermocellum DSM 1313: Clo1313_2052Help
Entry
Clo1313_2052      CDS       T01933                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clo1313_2052
Enzymes [BR:ctx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Clo1313_2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2422486..2423094)
Genome map
AA seq 202 aa AA seqDB search
MFAYIRGRLEYKNNDFLIVESNGVGYRIFTSLSTISGIGEIGQEVKVYTYLYVREDVISL
YGFLTQEELNVFELLISVSGVGPKAAVSVLSAISPSRFSLAVITDDVKTLTKAQGIGKKI
AQRIILELKDKIKKEQLTEYAQSEEGGKVLDTDSSKMAEAVSALMVLGYSPAEANKAVSA
VYREDMDIETIIKNALKGLARP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgcatatatcagaggaagacttgaatacaaaaacaatgattttttgattgttgaa
tcaaacggagtgggatacaggatttttacgtccctttccaccatttcgggcattggcgag
ataggacaggaagtaaaggtctacacatatctttatgttcgggaagacgttataagcttg
tatggatttttaactcaggaagagctcaatgtgtttgaactcttaatcagtgtttccggt
gtgggaccgaaggcggcggtatcggttttgtcggcaatatcgccctccaggttcagcctt
gcggttataaccgatgatgtaaagacattgacaaaagctcagggtataggaaagaaaatt
gcccaaaggataatacttgaacttaaggacaagataaagaaagaacagctgacagaatat
gcccaaagtgaagaaggcggcaaagttttggacacggacagttcaaaaatggcggaggcg
gtaagcgcccttatggttttgggatattctccggctgaagcaaataaagcggtatcggcg
gtttacagggaggatatggacatcgaaacgataattaaaaatgctcttaaaggactggca
agaccttaa

DBGET integrated database retrieval system