KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_2093Help
Entry
Clo1313_2093      CDS       T01933                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
ctx00010  Glycolysis / Gluconeogenesis
ctx00051  Fructose and mannose metabolism
ctx00562  Inositol phosphate metabolism
ctx01100  Metabolic pathways
ctx01110  Biosynthesis of secondary metabolites
ctx01120  Microbial metabolism in diverse environments
ctx01130  Biosynthesis of antibiotics
ctx01200  Carbon metabolism
ctx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1313_2093
   00051 Fructose and mannose metabolism
    Clo1313_2093
   00562 Inositol phosphate metabolism
    Clo1313_2093
Enzymes [BR:ctx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Clo1313_2093
Exosome [BR:ctx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Clo1313_2093
  Exosomal proteins of bladder cancer cells
   Clo1313_2093
  Exosomal proteins of melanoma cells
   Clo1313_2093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU75134
Position
complement(2460156..2460911)
Genome map
AA seq 251 aa AA seqDB search
MSRKVIAAGNWKMNKTPKEAVEFVQALKGRVADADTEVVVGVPFVCLPGVVEAAKGSNIK
VAAQNMHWEEKGAFTGEVSGPMLAELGVDYVIIGHSERRQYFGETDETVNKKVHAAFKYG
LKPIICVGESLTQREQGVTAELVRYQVKIALLGLSAEQVKEAVIAYEPIWAIGTGKTATN
EQAEEVCGIIRECIKELYGQDVAEAIRIQYGGSVNAANAAELFNMPNIDGGLVGGASLKL
DDFEKIAKYNK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaaagttattgcagccggaaactggaaaatgaacaaaacaccgaaggaagcc
gttgagttcgtacaggctttaaaaggaagagtggcagatgccgataccgaagtagtggta
ggtgtgccctttgtatgtttgcctggagttgttgaggcggcaaaaggatcaaatatcaag
gttgccgcacaaaacatgcactgggaggaaaaaggtgcttttaccggagaagtatccgga
cctatgctggccgaacttggtgttgactatgttatcataggtcactccgaaagaagacaa
tacttcggtgaaacagatgaaactgttaataaaaaggtacatgcggcattcaaatatggc
ttaaagccgattatctgcgttggtgagtccctcactcaaagagaacagggggttaccgcc
gaactggtaagataccaggttaagattgctttgctgggactttccgccgaacaggtgaaa
gaggctgtaatagcctatgaacctatctgggccattggtacaggaaagactgctacaaat
gagcaggcagaagaagtttgcggcataataagagaatgcataaaagagctttacggtcag
gatgttgccgaagctatcagaattcagtacggcggaagtgttaatgctgccaatgcggca
gaactcttcaatatgccgaacatcgacggaggccttgtgggaggcgcaagcttaaagctt
gatgactttgagaaaatcgcaaagtacaacaagtaa

DBGET integrated database retrieval system