KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_2093Help
Entry
Clo1313_2093      CDS       T01933                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1313_2093
   01230 Biosynthesis of amino acids
    Clo1313_2093
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1313_2093
   00051 Fructose and mannose metabolism
    Clo1313_2093
   00562 Inositol phosphate metabolism
    Clo1313_2093
Enzymes [BR:ctx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Clo1313_2093
Exosome [BR:ctx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Clo1313_2093
  Exosomal proteins of bladder cancer cells
   Clo1313_2093
  Exosomal proteins of melanoma cells
   Clo1313_2093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2460156..2460911)
Genome map
AA seq 251 aa AA seqDB search
MSRKVIAAGNWKMNKTPKEAVEFVQALKGRVADADTEVVVGVPFVCLPGVVEAAKGSNIK
VAAQNMHWEEKGAFTGEVSGPMLAELGVDYVIIGHSERRQYFGETDETVNKKVHAAFKYG
LKPIICVGESLTQREQGVTAELVRYQVKIALLGLSAEQVKEAVIAYEPIWAIGTGKTATN
EQAEEVCGIIRECIKELYGQDVAEAIRIQYGGSVNAANAAELFNMPNIDGGLVGGASLKL
DDFEKIAKYNK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaaagttattgcagccggaaactggaaaatgaacaaaacaccgaaggaagcc
gttgagttcgtacaggctttaaaaggaagagtggcagatgccgataccgaagtagtggta
ggtgtgccctttgtatgtttgcctggagttgttgaggcggcaaaaggatcaaatatcaag
gttgccgcacaaaacatgcactgggaggaaaaaggtgcttttaccggagaagtatccgga
cctatgctggccgaacttggtgttgactatgttatcataggtcactccgaaagaagacaa
tacttcggtgaaacagatgaaactgttaataaaaaggtacatgcggcattcaaatatggc
ttaaagccgattatctgcgttggtgagtccctcactcaaagagaacagggggttaccgcc
gaactggtaagataccaggttaagattgctttgctgggactttccgccgaacaggtgaaa
gaggctgtaatagcctatgaacctatctgggccattggtacaggaaagactgctacaaat
gagcaggcagaagaagtttgcggcataataagagaatgcataaaagagctttacggtcag
gatgttgccgaagctatcagaattcagtacggcggaagtgttaatgctgccaatgcggca
gaactcttcaatatgccgaacatcgacggaggccttgtgggaggcgcaagcttaaagctt
gatgactttgagaaaatcgcaaagtacaacaagtaa

DBGET integrated database retrieval system