KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_2093Help
Entry
Clo1313_2093      CDS       T01933                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1313_2093
   01230 Biosynthesis of amino acids
    Clo1313_2093
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1313_2093
   00051 Fructose and mannose metabolism
    Clo1313_2093
   00562 Inositol phosphate metabolism
    Clo1313_2093
Enzymes [BR:ctx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Clo1313_2093
Exosome [BR:ctx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Clo1313_2093
  Exosomal proteins of bladder cancer cells
   Clo1313_2093
  Exosomal proteins of melanoma cells
   Clo1313_2093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2460156..2460911)
Genome map
AA seq 251 aa AA seqDB search
MSRKVIAAGNWKMNKTPKEAVEFVQALKGRVADADTEVVVGVPFVCLPGVVEAAKGSNIK
VAAQNMHWEEKGAFTGEVSGPMLAELGVDYVIIGHSERRQYFGETDETVNKKVHAAFKYG
LKPIICVGESLTQREQGVTAELVRYQVKIALLGLSAEQVKEAVIAYEPIWAIGTGKTATN
EQAEEVCGIIRECIKELYGQDVAEAIRIQYGGSVNAANAAELFNMPNIDGGLVGGASLKL
DDFEKIAKYNK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaaagttattgcagccggaaactggaaaatgaacaaaacaccgaaggaagcc
gttgagttcgtacaggctttaaaaggaagagtggcagatgccgataccgaagtagtggta
ggtgtgccctttgtatgtttgcctggagttgttgaggcggcaaaaggatcaaatatcaag
gttgccgcacaaaacatgcactgggaggaaaaaggtgcttttaccggagaagtatccgga
cctatgctggccgaacttggtgttgactatgttatcataggtcactccgaaagaagacaa
tacttcggtgaaacagatgaaactgttaataaaaaggtacatgcggcattcaaatatggc
ttaaagccgattatctgcgttggtgagtccctcactcaaagagaacagggggttaccgcc
gaactggtaagataccaggttaagattgctttgctgggactttccgccgaacaggtgaaa
gaggctgtaatagcctatgaacctatctgggccattggtacaggaaagactgctacaaat
gagcaggcagaagaagtttgcggcataataagagaatgcataaaagagctttacggtcag
gatgttgccgaagctatcagaattcagtacggcggaagtgttaatgctgccaatgcggca
gaactcttcaatatgccgaacatcgacggaggccttgtgggaggcgcaagcttaaagctt
gatgactttgagaaaatcgcaaagtacaacaagtaa

DBGET integrated database retrieval system