KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_2439Help
Entry
Clo1313_2439      CDS       T01933                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
ctx00330  Arginine and proline metabolism
ctx00332  Carbapenem biosynthesis
ctx01100  Metabolic pathways
ctx01130  Biosynthesis of antibiotics
ctx01230  Biosynthesis of amino acids
Module
ctx_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Clo1313_2439
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Clo1313_2439
Enzymes [BR:ctx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Clo1313_2439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ADU75453
Position
complement(2851784..2852617)
Genome map
AA seq 277 aa AA seqDB search
MESSNLRKYLSDSKRIVIKVGTSTLTYENGEMNLARMEKLVRVISDLMNQGKDVVLVTSG
AIGVGVSKLKLGSRPKELKDKQAVAAVGQCELMYMYSKLFLEYGHTVGQILLTRDVVENP
TGKTNVINTFETLLEMRIIPIVNENDSVAVDEIESETNHVFGDNDTLSAIVATLVNADLL
IILSDIDGFYDCDPRANECSKLISVIEKITPELEKCAGGVGSSRGTGGMVTKLSAAKIAT
LAGINMVLANGDNPNIVYDILAGKEVGSLFLAQKSDS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggaaagttcaaatttaagaaagtatttgtctgattccaaaagaatagtaataaaagta
ggtacttcgactcttacatatgagaacggtgaaatgaatcttgcaaggatggaaaaacta
gtaagggttatatcggaccttatgaaccagggcaaagatgtggtattggttacgtccgga
gcaataggtgtcggcgtcagcaagctgaaactgggttcaaggccgaaagagttgaaagac
aagcaagccgttgccgccgtaggtcagtgcgaacttatgtatatgtacagtaaattgttc
ttggaatacggtcatacagtgggacagattcttttaacccgtgacgtggttgaaaatccc
acgggtaagaccaatgtaataaacacttttgagactttgcttgaaatgagaataattcct
atagttaatgaaaacgactcggtggccgttgatgaaatagaatccgaaacaaaccacgtg
tttggggacaacgacacgttgtcggcaatcgttgcgactttggttaatgcggatttgttg
ataattttatcggatattgacggattttatgactgtgacccgagagccaatgagtgttca
aaacttatttcggtgattgagaaaataacacctgagcttgagaaatgtgcgggaggagtt
ggaagctcaaggggcaccgggggcatggttaccaagctttccgctgcaaagattgccact
ttggcaggtataaacatggttcttgccaacggtgataatccgaatattgtttatgacatt
ttggcaggcaaggaagtgggttcacttttcctggcccaaaaatcagactcttga

DBGET integrated database retrieval system