KEGG   Clostridium thermocellum DSM 1313: Clo1313_2530Help
Entry
Clo1313_2530      CDS       T01933                                 

Definition
glycoside hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ctx  Clostridium thermocellum DSM 1313
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2967666..2969525)
Genome map
AA seq 619 aa AA seqDB search
MLKKKLLTLLTVFALLTVGICGSFLPLPKASAAALIYDDFETGLNGWGPRGPETVELTTE
EAYSGRYSLKVSGRTSTWNGPMVDKTDVLTLGESYKLGVYVKFVGDSYSNEQRFSLQLQY
NDGAGDVYQNIKTATVYKGTWTLLEGQLTVPSHAKDVKIYVETEFKNSPSPQDLMDFYID
DFTATPANLPEIEKDIPSLKDVFAGYFKVGGAATVAELAPKPAKELFLKHYNSLTFGNEL
KPESVLDYDATIAYMEANGGDQVNPQITLRAARPLLEFAKEHNIPVRGHTLVWHSQTPDW
FFRENYSQDENAPWASKEVMLQRLENYIKNLMEALATEYPTVKFYAWDVVNEAVDPNTSD
GMRTPGSNNKNPGSSLWMQTVGRDFIVKAFEYARKYAPADCKLFYNDYNEYEDRKCDFII
EILTELKAKGLVDGMGMQSHWVMDYPSISMFEKSIRRYAALGLEIQLTELDIRNPDNSQW
ALERQANRYKELVTKLVDLKKEGINITALVFWGITDATSWLGGYPLLFDAEYKAKPAFYA
IVNSVPPLPTEPPVQVIPGDVNGDGRVNSSDLTLMKRYLLKSISDFPTPEGKIAADLNED
GKVNSTDLLALKKLVLREL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaaaaactgttgacccttttgacagtctttgctctgctgactgtcggtatc
tgcggaagttttttgccgttacccaaagcatccgcagcagctctgatttacgatgatttt
gaaacaggtctgaacggatggggaccaagaggaccggaaaccgtcgaacttaccaccgag
gaagcttactcgggaagatacagtttgaaggtcagcggacgtaccagcacatggaacggg
cccatggttgacaaaaccgatgtgttgactttgggcgaaagctataagttgggcgtatat
gtaaaattcgtgggtgattcctattcaaatgagcaaagattcagtttgcagcttcaatat
aacgacggagcaggagatgtataccaaaatataaaaaccgccacggtttacaagggaaca
tggactttgctggaaggacagcttacagttcccagccatgcaaaggacgtaaaaatatat
gtggaaaccgaatttaaaaattctccgagtccgcaggacttgatggatttctatattgac
gatttcacagcaacacctgcaaatttgcctgaaattgagaaagatattccaagcttgaaa
gatgtctttgccggttatttcaaagtgggtggtgccgcaactgtggcggaactggcgccg
aagcctgcaaaagagcttttcctcaagcattataacagcttgacttttggtaatgagtta
aaaccggaaagtgtacttgactatgatgctacaattgcttatatggaggcaaacggaggc
gaccaggttaatccgcagataaccttgagagcggcaagacccctgttggagtttgcgaaa
gaacacaacatacctgtaagaggacatacccttgtatggcacagccagacaccggactgg
ttcttcagagaaaattactctcaggacgaaaatgctccctgggcatccaaggaagtaatg
ctgcaaaggttggaaaactacataaagaatttaatggaagctttggcgaccgaatatccg
acggttaagttctatgcatgggacgttgtgaatgaggctgttgatcctaatacttcagac
ggtatgagaactccgggttcgaataacaaaaatcccggaagctccctgtggatgcaaacc
gttggaagagattttattgttaaagcttttgaatatgcaagaaaatatgctcctgcggat
tgtaaactcttctacaatgactataatgaatatgaagacagaaaatgtgattttattatt
gaaattcttaccgaacttaaagccaaaggcctggttgacggtatgggtatgcaatcccac
tgggttatggattatccaagcataagcatgtttgaaaaatccatcagaagatatgcagca
ttgggattggaaattcagcttaccgagctggatataagaaatcctgacaacagccagtgg
gctttggaacgtcaggctaatcgttataaggagcttgtaacaaaattggtcgatttgaaa
aaagaaggcataaacattacggcattggtattctggggaataaccgacgcgacaagctgg
cttggaggatatccgctcctgtttgacgcggaatacaaggcaaaacctgcattttatgct
atagttaacagcgttccgccgcttccgacagaaccgccggttcaggttatacccggtgac
gtaaacggtgacggtcgtgtaaattcatccgacttgactcttatgaaaagatacctttta
aaatccataagcgacttcccgacaccggaaggaaaaattgcggcggatttaaacgaagac
ggcaaggtaaactcgacagatttgttagcgctgaaaaaactcgttctgagagaactttga

DBGET integrated database retrieval system