KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_2635Help
Entry
Clo1313_2635      CDS       T01933                                 

Definition
glycoside hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Brite
Enzymes [BR:ctx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Clo1313_2635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3101534..3104047)
Genome map
AA seq 837 aa AA seqDB search
MSRKLFSVLLVGLMLMTSLLVTISSTSAASLPTMPPSGYDQVRNGVPRGQVVNISYFSTA
TNTTRPARVYLPPGYSKDKKYSVLYLLHGIGGSENDWFEGGGRANVIADNLIAEGKIKPL
IIVTPNTNAAGPGIADGYENFTKDLLNSLIPYIESNYSVYTDREHRAIAGLSMGGGQSFN
IGLTNLDKFAYIGPISAAPNTYPNERLFPDGGKAAREKLKLLFIACGTNDSLIGFGQRVH
EYCVANNINHVYWLIQGGGHDFNVWKPGLWNFLQMADEAGLTRDGNTPVPTPSPKPANTR
IEAEDYDGINSSSIEIIGVPPEGGRGIGYITSGDYLVYKSIDFGNGATSFKAKVANANTS
NIELRLNGPNGTLIGTLSVKSTGDWNTYEEQTCSISKVTGINDLYLVFKGPVNIDWFTFG
VESSSTGLGDLNGDGNINSSDLQALKRHLLGISPLTGEALLRADVNRSGKVDSTDYSVLK
RYILRIITEFPGQGDVQTPNPSVTPTQTPIPTISGNALRDYAEARGIKIGTCVNYPFYNN
SDPTYNSILQREFSMVVCENEMKFDALQPRQNVFDFSKGDQLLAFAERNGMQMRGHTLIW
HNQNPSWLTNGNWNRDSLLAVMKNHITTVMTHYKGKIVEWDVANECMDDSGNGLRSSIWR
NVIGQDYLDYAFRYAREADPDALLFYNDYNIEDLGPKSNAVFNMIKSMKERGVPIDGVGF
QCHFINGMSPEYLASIDQNIKRYAEIGVIVSFTEIDIRIPQSENPATAFQVQANNYKELM
KICLANPNCNTFVMWGFTDKYTWIPGTFPGYGNPLIYDSNYNPKPAYNAIKEALMGY
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagaaaacttttcagtgtattacttgttggcttgatgcttatgacatcgttgctt
gtcacaataagcagtacatcagcggcatccttgccaaccatgccgccttcgggatatgac
caggtaaggaacggcgttccgagagggcaggtcgtaaatatttcttatttctccacggcc
accaacactaccaggccggcaagagtttatttgccgccgggatattcaaaggacaaaaaa
tacagtgttttgtatctcttacacggcataggcggtagtgaaaacgactggttcgaaggg
ggaggcagagccaatgttattgccgacaatctgattgccgagggaaaaatcaagcccctg
ataattgtaacaccgaatactaacgccgccggtccgggaatagcggacggttatgaaaat
ttcacaaaagatttgctcaacagtcttattccctatatcgaatctaactattcagtctac
accgaccgcgaacatcgggcgattgcaggactttcaatgggtggaggacaatcgtttaat
attggattgaccaatctcgataaatttgcctatattggcccgatttcagcggctccaaac
acttatccaaatgagaggctttttcctgacggaggaaaagctgcaagggagaaattgaaa
ctgctctttattgcctgcggaaccaatgacagtctgataggttttggacagagagtacat
gaatattgcgttgccaacaacattaaccatgtctattggcttattcagggcggaggacac
gattttaatgtgtggaagcccggattgtggaatttccttcaaatggcagatgaagccgga
ttgacgagggatggaaacactccggttccgacacccagtccaaagccggctaacacacgt
attgaagcggaagattatgacggtattaattcttcaagtattgagataataggtgttcca
cctgaaggaggcagaggaataggttatattaccagtggtgattatctggtatacaagagt
atagactttggaaacggagcaacgtcgtttaaggccaaggttgcaaatgcaaatacttcc
aatattgaacttagattaaacggtccgaatggtactctcataggcacactctcggtaaaa
tccacaggagattggaatacatatgaggagcaaacttgcagcattagcaaagtcaccgga
ataaatgatttgtacttggtattcaaaggccctgtaaacatagactggttcacttttggc
gttgaaagcagttccacaggtctgggggatttaaatggtgacggaaatattaactcgtcg
gaccttcaggcgttaaagaggcatttgctcggtatatcaccgcttacgggagaggctctt
ttaagagcggatgtaaataggagcggcaaagtggattctactgactattcagtgctgaaa
agatatatactccgcattattacagagttccccggacaaggtgatgtacagacacccaat
ccgtctgttactccgacacaaactcctatccccacgatttcgggaaatgctcttagggat
tatgcggaggcaaggggaataaaaatcggaacatgtgtcaactatccgttttacaacaat
tcagatccaacctacaacagcattttgcaaagagaattttcaatggttgtatgtgaaaat
gaaatgaagtttgatgctttgcagccgagacaaaacgtttttgatttttcgaaaggagac
cagttgcttgcttttgcagaaagaaacggtatgcagatgaggggacatacgttgatttgg
cacaatcaaaacccgtcatggcttacaaacggtaactggaaccgggattcgctgcttgcg
gtaatgaaaaatcacattaccactgttatgacccattacaaaggtaaaattgttgagtgg
gatgtggcaaacgaatgtatggatgattccggcaacggcttaagaagcagcatatggaga
aatgtaatcggtcaggactaccttgactatgctttcaggtatgcaagagaagcagatccc
gatgcacttcttttctacaatgattataatattgaagacttgggtccaaagtccaatgcg
gtatttaacatgattaaaagtatgaaggaaagaggtgtgccgattgacggagtaggattc
caatgccactttatcaatggaatgagccccgagtaccttgccagcattgatcaaaatatt
aagagatatgcggaaataggcgttatagtatcctttaccgaaatagatatacgcatacct
cagtcggaaaacccggcaactgcattccaggtacaggcaaacaactataaggaacttatg
aaaatttgtctggcaaaccccaattgcaatacctttgtaatgtggggattcacagataaa
tacacatggattccgggaactttcccaggatatggcaatccattgatttatgacagcaat
tacaatccgaaaccggcatacaatgcaataaaggaagctcttatgggctattga

DBGET integrated database retrieval system