KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_2847Help
Entry
Clo1313_2847      CDS       T01933                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clo1313_2847
   00052 Galactose metabolism
    Clo1313_2847
   00500 Starch and sucrose metabolism
    Clo1313_2847
   00520 Amino sugar and nucleotide sugar metabolism
    Clo1313_2847
Enzymes [BR:ctx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Clo1313_2847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3343572..3344441)
Genome map
AA seq 289 aa AA seqDB search
MRVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIKSGIEDIIIISGRSK
RAIEDHFDKSYELEQELKKKGNHDLLKLVQDISNLANIHYIRQKEAKGLGHAIYCAKSFI
GNEPFAVLLGDDIVDSEVPCIKQLMDVYDKYRTTVLGVQKVPEDQVSKYGIVGGEIVSDR
VYKVKDLVEKPDTASAPSNIAILGRYIITPRIFDYLENAKPGKGGEIQLTDALRELMGEE
EMYAYDFIGKRYDVGNKLGFLQATVEFALARDDLKEEFEAYLKEIICKL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgagagtcagaaaagcaataattcctgcagcaggtctgggaaccagatttctacccgcc
acaaaagcgcagcccaaagaaatgcttcctattgttgacaagcctacaattcaatatatt
gttgaagaagccataaagtcaggtatagaagatattataattatttcgggaagaagcaaa
agagcgatagaagaccactttgacaaatcatatgagctggagcaggagcttaaaaaaaaa
ggaaaccatgaccttcttaagctggttcaagatatatcaaacttggcaaacatacattac
atacgacaaaaagaagcaaaaggtctgggacatgccatatattgtgcaaagtcctttatt
ggcaacgagccttttgcagtgctgttaggcgatgatattgtggattcagaggtgccttgc
atcaaacaattgatggatgtgtatgataagtacagaacaacggttttgggagtacagaaa
gttcccgaagatcaagtatccaagtatggtatagtgggcggggagattgtgagtgacagg
gtgtacaaggtgaaagatcttgtggagaagcctgacacagccagtgcaccgtccaatata
gccatcctgggaagatatattattactccaaggattttcgattatcttgagaatgcaaaa
cccggcaagggaggagagattcagctgacagacgcattaagagagctgatgggagaggaa
gaaatgtacgcttatgattttatcggaaagcgttacgatgtgggaaacaaacttggattc
ttacaagcaacggtggagtttgctctggcaagagatgacttgaaagaagaattcgaggca
tatttgaaagagattatctgtaaactgtaa

DBGET integrated database retrieval system