KEGG   Clostridium thermocellum DSM 1313: Clo1313_2854Help
Entry
Clo1313_2854      CDS       T01933                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ctx  Clostridium thermocellum DSM 1313
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clo1313_2854
Enzymes [BR:ctx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Clo1313_2854
Exosome [BR:ctx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clo1313_2854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3349919..3352132
Genome map
AA seq 737 aa AA seqDB search
MNTTANIDEVYKVINAEHHDPFSVLGMHRLESENAMVVRAYLPNAKEIEVVELSKNNTYP
MEKIDERGFFEVVIKDRNDFFKYNLRATDYVGNTFTFYDPYCFMPVISDYDLYLFNEGNH
HKIYEKLGTHRMTIDGVEGTLFAVWAPCAKRVSVVGNFNQWDGRRHQMRVRGSSGVWELF
IPGVGEGELYKYEIKTPHNEIYIKADPYAFYSELRPNTASIVYDIEGYEWHDADWMRERD
SSNSFDKPISIYEVHLGSWKRVSNDENGFYSYRELADMLVEYVKYMGYTHIELLPIAEHP
FDGSWGYQVTGYYAATSRYGQPKDFMYFVDKCHQNGIGVIIDWVPAHFPKDGHGLARFDG
TALYEHYDPKQGEHPDWGTHIFNYGRNEVKNFLIANAMFWFDKYHIDGLRVDAVASMLYL
DYGKKDGEWIPNRWGGKENVDAIEFMRQLNSTVFQYFPGVMMIAEESTAWALVTKPPYTG
GLGFSYKWNMGWMNDFLRYMSMDSVYRKYHQNLITFSLMYAFSENFILVLSHDEVVHGKC
SMINKMPGDYWQKFAGLRASYGYLYGHPGKKLLFMGGEFAQFIEWNYKQSLDWFLLDYDM
HKKMQDYVRDLNKLYRSEKALYEVDFHYDGFEWIDCNDTEHSIISFMRKGKDWHNSLIFV
CNFTPVPHEDYRIGSPFNTTYDEIFNSDWEKYGGSNVGNFEPIKAEEISMHNKPYSMRLR
IPPLATIVLKPRFDRKD
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaacagcaaatattgacgaggtttacaaggttatcaatgcagagcatcatgat
ccgttcagtgtgctgggaatgcaccgtctggaatctgagaatgcaatggtcgtaagggca
tatctgccaaatgcaaaagaaatagaagtagtggaactctccaaaaacaacacataccca
atggagaaaatcgacgagaggggcttttttgaggttgtaataaaagacaggaatgacttt
ttcaagtataacctgagggccaccgactacgtaggcaacacttttaccttttacgaccct
tactgtttcatgcccgtgatctctgactatgacctttatttattcaatgagggcaaccat
cataaaatctacgaaaagcttggtacccacagaatgactattgacggtgttgaaggcaca
ctttttgccgtttgggccccctgtgcaaaacgcgtaagtgttgtgggaaatttcaaccag
tgggacggccgcaggcaccaaatgagagtgagaggaagttccggagtatgggagttgttt
attccgggtgttggtgaaggcgagctttacaaatatgaaataaagacacctcacaacgaa
atttacatcaaagccgacccctatgctttttattcggaacttcggccaaatacagcttcc
atcgtgtatgatattgaaggatatgaatggcatgacgcagactggatgcgtgaaagagac
agcagcaattcctttgacaagcccatatccatatacgaagtgcatcttggctcatggaaa
agagtctccaacgatgaaaacggcttttactcatacagggaacttgcagatatgctggta
gagtatgtgaaatacatgggttacacccatattgaacttctgccgattgcagaacatcct
tttgacggttcgtggggataccaggttacaggatattatgcagcaaccagcagatacgga
cagccaaaagattttatgtattttgtggacaaatgccaccaaaacggcataggagttata
atcgactgggtaccggctcattttcccaaagacggccacggtctggcaagatttgacggc
acagccctgtatgagcattacgaccccaaacaaggcgagcatcctgactggggaactcat
atattcaattacggaagaaatgaagttaaaaacttcttaattgccaatgccatgttctgg
ttcgataaataccatattgacggacttagggttgacgcagtggcatccatgctctatctg
gattacggcaaaaaggacggggaatggatacccaatcgctggggaggaaaagaaaacgtc
gacgccattgagtttatgaggcagctgaattcaaccgtgttccaatacttccccggtgtt
atgatgatcgctgaggaatccacagcctgggctttagtaaccaaacctccttacacaggt
ggtcttggcttctcgtacaaatggaacatgggctggatgaacgactttttgcgctatatg
agtatggactcggtatacagaaagtaccatcaaaatcttataaccttctccctgatgtac
gctttctcggaaaactttatacttgtactctcccatgacgaagtagtacacggcaaatgc
tccatgataaacaaaatgccgggagattactggcaaaagtttgcgggcctgcgtgcaagc
tacggttacctgtacggccatcccggcaagaaacttcttttcatggggggagaatttgca
cagtttattgaatggaactacaagcaaagccttgactggttcctgctggattatgacatg
cataagaaaatgcaggattatgtacgggacctcaacaagctttacagaagcgaaaaagca
ctgtatgaagttgatttccattatgatggctttgaatggatagattgcaacgatacggaa
cacagcattatttcctttatgagaaagggcaaggactggcataattctctcatatttgtg
tgcaacttcactcccgtgccccatgaagactaccgcattggttcgccttttaacaccact
tatgatgagattttcaacagcgactgggaaaaatacggcggaagcaatgtcggaaacttc
gagcctattaaggctgaagagataagcatgcacaacaaaccttattccatgaggcttcgc
attccgccgcttgcaacaattgtgctaaagccaaggtttgacaggaaggattaa

DBGET integrated database retrieval system