KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_2876Help
Entry
Clo1313_2876      CDS       T01933                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Clo1313_2876
Enzymes [BR:ctx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Clo1313_2876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3383863..3384426)
Genome map
AA seq 187 aa AA seqDB search
MIDKERIKAAVRELLIGIGEDPDREGLLETPDRVARMCEEIFAGLHQDPKSVVKVFQEEN
HEEMVMVKDIPIYSICEHHLLPFIGVAHVVYIPRKGKIMGLSKLARIVDIIARKPQLQER
LGSEVANVIMESINPLGVAVVVEAEHLCMTMRGIKKAGSKTVTSALRGIIKTDARTRAEV
MALINGR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgatagacaaagagcgtataaaggctgctgtaagggaactgctgatcggaattggagaa
gaccctgaccgtgagggattgcttgagactcccgaccgggtggcaaggatgtgtgaggaa
atatttgccggacttcatcaggacccaaagtccgttgtaaaggtgtttcaggaggaaaac
cacgaggaaatggtgatggtgaaagatattcccatttactcaatttgtgagcatcacctg
ctgccgtttataggagtggcacatgtggtttatattccaagaaaaggcaaaattatgggg
cttagcaaacttgccaggatagttgacattatcgccagaaaaccgcagcttcaggaaagg
cttggcagtgaagtcgccaatgtcataatggagtccataaatcccttgggagttgcagtg
gtggtggaggctgaacacttgtgcatgacaatgaggggaataaagaaggcgggttcaaaa
accgtaacttcagcacttcggggtattatcaagaccgatgcccggaccagggcggaggtt
atggctctcataaacggaagatga

DBGET integrated database retrieval system