KEGG   Chlamydia trachomatis A2497: CTR_0331Help
Entry
CTR_0331          CDS       T01707                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cty  Chlamydia trachomatis A2497
Pathway
cty03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cty00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CTR_0331 (recD)
Enzymes [BR:cty01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CTR_0331 (recD)
DNA repair and recombination proteins [BR:cty03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CTR_0331 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 HHH_5 T2SSE PhoH UvrD-helicase AAA_16 HHH AAA_12 RsgA_GTPase DUF2075 AAA_22 AAA_29 ABC_tran AAA_28 HHH_2 Mg_chelatase Zeta_toxin Terminase_6
Motif
Other DBs
NCBI-ProteinID: CAX08691
UniProt: G4NNY4
Position
complement(37094..39334)
Genome map
AA seq 746 aa AA seqDB search
MGCEEKLSGILELILPEDPLSDQTGYAFLRVPYKNSLVTVCGHLPLSLFKIGSSVDLTGH
WSVDASGALVFHFTSAATYSPDSGIIAYLNAQIKGVGPKLAQKIVSTFREDTLTVLDSCP
SKLVEVDGISPARCEDFSKQLQEQRDLRHALLFLQRHGIAIHYGLRLYKKYQNQTIEKVC
QDPFLLAKEMYGIGFKTADLIATCLGVPLNSPNRIVAGIQYSLDELQEEGHTCYPLNDFI
VLVEKLLNEEAPEEIIRKEEIRTQIHFLSRQKTVYVKELEQDTYIWSRQLFLAEQQIAID
IRRLLFSSKRIRSINTQEAILEVENLLDLKLEEKQKEALHASSSQKIHIISGGPGTGKST
ITRAILSIFEKISSPKKIILAAPTGKAAKRMTEITGKRTQTIHSLLQYDFKTLSFRKNHE
DPIDCDLVIVDESGMIDTILLQRFLAALPDHAILILIGDVHQLPSVGPGNVLKDLILSHH
IEVTYLTKIFRQLQNSNIITNAHKVNQGEFPVLNSSSGKKDFLFFQKEDPEEAIKHIIHL
VSDFVPKKFGIFTEDIQVLAPMRKGVLGILNLNRELKAALNPNKLFIQGKFHSFSTGDRV
MQTRNNYNKEVFNGDIGYVTSIDLSTKSLIVCVDGRYISYSQAELNDLIPAYATSIHKYQ
GSETSCIILPIHTSHYVMLYRNLLYTAITRGKKLVILVGTKKAVAIAVRNNKVQHRCTGL
QQAMHSLLNKPTPLFSPYTICRPSLG
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtgaagagaaactttccggtattttggagctgatcctgccagaagatcccctg
tccgatcaaacagggtacgccttcctacgagtcccttacaaaaattcactagtaactgtt
tgtggccatctcccgctctctttgtttaaaatcggctcctctgtagacttaacaggtcat
tggagtgtagatgctagcggagcattagtgtttcactttacttccgctgcaacctatagt
cctgattccggaatcatagcttacctgaatgctcaaatcaaaggcgtaggccccaaactt
gctcaaaaaattgtctcaaccttcagggaagacacgttaacagtactcgattcctgtcct
tctaaattggtagaagtagatgggatttctcctgcccgctgcgaagatttttctaagcaa
ctccaagagcaaagagacctacgtcatgctttgttatttctacaacgacatggaatagcc
attcattatggtttacggctgtataaaaaataccaaaatcaaacgatcgagaaggtctgt
caagatccctttctgcttgcaaaggaaatgtacggtataggttttaaaaccgctgatctt
attgctacgtgcttaggagtccctctaaattcccctaatcgtatcgttgctggaattcaa
tactctctagatgaacttcaagaagaagggcatacctgctaccctcttaatgattttatt
gttctcgtagaaaaactgttgaatgaagaagctccagaggagatcatacggaaagaggaa
atccgtacccaaatccatttcttgtcacgccagaagacagtctatgtcaaggaactcgaa
caagatacctatatttggtcgcgccaactttttctagctgaacaacaaattgcgattgat
attcgaagactcttgttttcttctaaacgaatacgatctatcaatacccaggaagcgatt
ctggaggttgaaaatcttctggatttgaaattagaagaaaaacaaaaagaagctcttcat
gctagctcttcacaaaagattcatattatatctgggggaccaggaacaggaaaaagtaca
attacacgtgctatcctttctatctttgaaaagatctcctcccctaagaaaataatccta
gcagcacctacaggaaaagctgcgaaacgtatgacagaaatcacagggaaacgtactcaa
actatccactctcttctccagtatgatttcaaaaccttgtcatttcgaaagaatcacgaa
gatcctattgattgtgatcttgttattgtcgatgaatccggaatgatcgacaccattctc
ttacagcgctttctagctgcactgcctgatcatgctatcctaattctaattggagatgtg
caccagcttcccagcgtaggccctggtaatgtccttaaagatcttattctttcccatcac
atcgaggtaacctacctaacgaaaatcttccgtcagttgcaaaattcgaatatcattaca
aatgcccataaagtaaaccaaggagaattcccggttctcaacagctcttcagggaaaaaa
gactttttattttttcaaaaagaagaccctgaagaagcgattaaacacatcattcatctc
gtttcggattttgttcctaaaaaatttggtatctttaccgaagatattcaagtccttgct
cctatgagaaaaggggtattaggaatactcaatctaaatagagagttaaaagcagcactt
aatcctaataaactgtttatccaagggaaatttcactccttctctacgggagatcgcgtt
atgcaaacgcgtaataactataataaagaggtattcaacggagatatcggttatgtgacc
tctattgacctatctacaaagagtttgatcgtttgcgtggatggccgctatattagttat
tcgcaagcagaactcaatgacctgataccagcttatgctacttccatacacaaataccaa
ggaagtgagacctcctgtattattcttcctattcacacctctcattacgtgatgctgtat
agaaacttactctatacagcaattacacgagggaaaaaactagtcattttagtaggaaca
aagaaagcagttgctattgctgttcgtaataataaggttcaacaccgatgtaccgggctg
caacaagctatgcactcccttcttaacaaaccaactcctcttttctctccttacactatt
tgtagaccgtctctaggataa

DBGET integrated database retrieval system