KEGG   Chlamydia trachomatis A2497: CTR_0541Help
Entry
CTR_0541          CDS       T01707                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cty  Chlamydia trachomatis A2497
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cty00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTR_0541 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTR_0541 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CTR_0541 (sucB)
Enzymes [BR:cty01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CTR_0541 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64212..65309
Genome map
AA seq 365 aa AA seqDB search
MSIEVRIPNIAESISEVTISALLIPSGDLVQENQGILEIESDKVNQLIYAPCSGKVEWSV
SVGDTVAVGSVVGIISEAEKSQDTAPIHEQMPFSLVEQESDAQIIAFPSSVRQDPPAEGK
TFVPLKEIQPASSDHRESRESMSAIRKTISRRLVQSLHDSAMLTTFNEIHMGPLIALRKE
RQEDFIAKYGVKLGFMSFFVRAVVDSLKKYPRVNAYIEDNEIVYRHYYDISIAIGTDRGL
VVPVIRNCDQLSSGEIELQLADLASRAREGKLAIHELEGGGFTITNGGVYGSLLSTPIIN
PPQVGILGMHKIEKRPVVREDAIVIADMMYVAMSYDHRIIDGKEAVGFLVNVKEQLEQPE
LLLKM
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagaggttcgtattcccaatatcgcagaatctattagtgaagtgacgatttct
gcacttttgattccatcaggagatttggtgcaggagaatcaagggattctggagatagag
agtgacaaggtgaatcagctcatttacgctccttgctcaggaaaggtagagtggagcgtt
tccgtaggagatacggtcgctgttggtagtgttgtagggattattagtgaagcggaaaag
agtcaagatactgcacctatccatgagcagatgccatttagtcttgtagagcaggaaagc
gatgcgcagattattgccttcccttcatcagtgagacaggatcctcctgcagaagggaaa
acttttgttccattaaaggagatccaaccagcttcttctgatcatagagaatctcgagaa
tctatgagtgctattcggaagacgatttctcgtagattggtgcaatctctacatgattca
gcaatgttaacgacatttaatgaaatccatatggggccgcttattgctctgcgtaaggaa
agacaagaagatttcattgcgaagtatggggtaaaacttgggttcatgtctttctttgtt
agagccgttgtagattctttgaaaaaatatccccgggtgaatgcttatattgaagataac
gaaatcgtttacagacattactacgatatttccattgccatagggacagatcgtggatta
gtagttcctgtaattcgtaattgtgatcagttatctagcggggagattgagttacagctt
gccgatttagcttctcgtgctcgggaaggcaaacttgctattcatgagttagaaggggga
ggcttcactattaccaatggaggggtatatggttctcttctatccactcccattatcaat
cctccacaggtaggtattcttgggatgcataagatagagaaacgccctgtggttagagaa
gatgcaattgtgatagccgatatgatgtatgtagctatgagctatgatcatcggattata
gacggaaaggaagccgtaggattccttgtgaatgttaaagagcaattagaacaacccgag
cttttgctaaaaatgtag

DBGET integrated database retrieval system