KEGG   Chlamydia trachomatis A2497: CTR_1641Help
Entry
CTR_1641          CDS       T01707                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cty  Chlamydia trachomatis A2497
Pathway
cty00260  Glycine, serine and threonine metabolism
cty00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cty01100  Metabolic pathways
cty01110  Biosynthesis of secondary metabolites
cty01130  Biosynthesis of antibiotics
cty01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cty00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTR_1641 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTR_1641 (trpB)
Enzymes [BR:cty01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTR_1641 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: CAX08830
Position
195050..196228
Genome map
AA seq 392 aa AA seqDB search
MFKHKHPFGGAFLPEELLAPIQNLKAEWEILKTQQSFLSELDCILKNYAGRQTPLTEVKN
FARAIDGPRVFLKREDLLHTGAHKLNNALGQCLLAKYLGKTRVVAETGAGQHGVATATAC
AYLGLDCVVYMGAKDVERQKPNVEKMRFLGAEVVSVTKGSCGLKDAVNQALQDWATTHSF
THYCLGSALGPLPYPDIVRFFQSVISAEVKEQIHAVAGRDPDILIACIGGGSNAIGFFHH
FIPNPKVQLIGVEGGGLGISSGKHAARFATGRPGVFHGFYSYLLQDDDGQVLQTHSISAG
LDYPSVGPDHTEMHESGRAFYTLATDEEALRAFFLLTRNEGIIPALESSHALAHLVSIAP
SLPKEQIVIVNLSGRGDKDLPQIIRRNRGIYE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacataaacatccttttgggggagcgttccttcccgaagaactattagcccct
atacagaatctaaaagcggaatgggagattctcaaaactcagcaaagttttttatctgaa
ctagattgtattttgaaaaactatgcggggagacaaactcctctgactgaagttaagaat
tttgctcgagctattgatggccctagagtatttcttaaacgcgaagatcttttgcataca
ggagcacataaactgaataatgctcttggtcagtgtttgcttgctaaatatcttgggaaa
acacgtgttgtagctgaaacaggtgcgggacaacatggagtagcaacagcaacagcgtgt
gcttatctaggattagattgtgtagtatacatgggagcaaaagatgtggaacgacagaaa
ccaaatgtagagaaaatgcgctttttaggtgctgaagtcgtttctgtaacaaaaggatct
tgtggactcaaagatgcagttaatcaagctctacaagattgggcaacaacacactcattt
actcactattgcttaggatcggccttaggacctttaccttatcccgatatcgttcgattt
tttcagtctgttataagcgctgaagtgaaagagcaaatccatgcagttgcaggaagagat
cctgatattctgattgcatgtatcggaggtggctccaacgctattggatttttccatcat
tttatcccgaatccaaaagtccaattaattggagtggaagggggaggactgggcatttct
tcaggaaaacatgcagcacgttttgcaacagggcgacctggagtattccacggattttat
tcgtatcttcttcaagatgacgatggacaagtattacaaactcactccatttccgctgga
ttagattatccttcagttgggccagatcataccgaaatgcatgagtcaggacgagccttt
tatacattagccaccgatgaagaggcgttacgagcttttttcctgcttactagaaacgag
gggattattcctgcattggagtcttcacatgctctcgcacatttagtttcgattgctcct
tctctaccaaaggaacaaatcgtcatcgttaacttatctggaagaggtgataaggatctt
ccacaaatcatccgcagaaacagaggaatttatgagtaa

DBGET integrated database retrieval system