KEGG   Chlamydia trachomatis A2497: CTR_4571Help
Entry
CTR_4571          CDS       T01707                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cty  Chlamydia trachomatis A2497
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cty00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cty00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(531633..532967)
Genome map
AA seq 444 aa AA seqDB search
MPGIKVFGETVLRGSVRVSGAKNATTKLLVASLLSDQRTILKNVPNIEDVRQTVDLCRVL
GAIVEWDQQAQVIEIHTPRILLSKVPPQFSCVNRIPILLLGALLRRCPYGIFVPILGGDA
IGPRTLHFHLEGLKKLGAEIVISDEGYWASAPNGLVGAHITLPYPSVGATENLILASVGA
QGRTIIKNAALEVEIIDLIVFLQKAGVEITTDNDKTIEIFGCQDFYSVEHSIIPDKIEAA
SFGMAAVVSQGRIFVEQARHEHMIPFLKVLRSIGGGFSVHENGIEFFYDKPLKGGVLLET
DVHPGFITDWQQPFAVLLSQSEGCSVIHETVHENRLGYLKGLVKMGAHCDLFHECLSAKS
CRYSTGNHPHSAVIHGPTPLQATDLVIPDLRAGFAYVMAALITEGGASWIENTEMLDRGY
TDWRGKLERLGAKVLARDSVSVYV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtatcaaggtttttggagaaacggtcttaagaggatctgtgcgcgtgtcagga
gctaaaaatgctacaactaaattacttgtagcctccttactttcggatcagcgaacgatt
ttaaagaacgtccctaatattgaagatgttcggcaaacggtagatctttgtcgggtttta
ggggcgattgtagagtgggatcagcaagcacaagtgattgaaattcacactccgcgcatt
ttattgtccaaggttcctccgcaattttcttgtgttaatcggattcctattttgctgtta
ggagcgttgttacgtcgttgtccttatgggatttttgttcctattttgggaggggatgct
ataggacctcgtacgctacatttccatttagaaggattgaagaagcttggagcagagata
gtaattagtgatgaaggctattgggcttcagctccaaatggtcttgttggagcacacatc
acgttaccctacccttctgtgggagccacagaaaacctcatccttgcttctgtaggggct
caaggacgaacgattattaagaatgctgctcttgaagtggaaatcattgatttgattgtc
tttttacagaaagcaggcgtggagattacaacagataatgataagaccatcgaaattttt
ggatgtcaggatttctattctgttgagcactccattattccagataaaatcgaggctgct
tctttcggtatggctgcggtagtttctcagggaaggatcttcgtagaacaagcgcgccat
gagcatatgatcccttttttaaaggtattaagatcgataggagggggattctctgtacat
gagaatgggatcgaatttttctacgataagcctttgaaagggggagttcttctagaaacg
gatgtgcatccagggtttattacagattggcaacaaccttttgccgtattgctctctcag
tcagaaggttgttcggtgatccatgagacagtgcatgagaatcgtcttgggtatttgaaa
ggtttggtaaaaatgggagcgcattgtgatttatttcacgagtgtttgagtgctaagtcg
tgtcgctattctacagggaatcatcctcatagcgcagtcattcatggtccgactcctttg
caggcaacagacttagtgattcctgatttgcgcgcaggatttgcttatgtcatggccgca
ctcattacagaaggcggagcctcatggattgagaataccgagatgctggatcgagggtac
actgattggcgagggaaattagaaagattaggagctaaggttttagcgcgagactcagta
tctgtgtatgtttaa

DBGET integrated database retrieval system