KEGG   Chlamydia trachomatis A2497: CTR_6161Help
Entry
CTR_6161          CDS       T01707                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cty  Chlamydia trachomatis A2497
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cty00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cty00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(694396..694875)
Genome map
AA seq 159 aa AA seqDB search
MIQATGIVAIDPRGVMGALGKLPWSYPEDLRFFAETIRNHPIIMGRKTWESLPDKYKHGR
DIVVFSRRMHPPQCIGVSSFAEYGTLSLNHPFLIGGAELFESFFQQNLLKACFVTHIKKE
YWGDTFFPITRLSGWKKECICNTEDFSIYYYENNSDQNT
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatccaagcaacaggtatcgttgctattgatcccagaggagtgatgggagctttaggc
aagctcccttggagttatcccgaagatctacgtttttttgcagaaaccattcgaaatcat
cccatcattatgggacgaaagacttgggagtctcttccagacaagtataagcatgggcgg
gatatcgttgtcttttctcgcaggatgcatccaccacaatgcataggagtttcttccttt
gcagagtatgggacactatctttgaatcatccgtttttaattgggggagcggagctcttt
gaaagttttttccaacaaaaccttctgaaagcttgttttgtcacacatatcaaaaaggaa
tattggggcgatactttcttccctatcacgcgattatcaggatggaagaaggaatgtatt
tgtaatacagaggatttcagtatttattattatgaaaataactccgatcaaaacacgtaa

DBGET integrated database retrieval system