KEGG   Chlamydia trachomatis A2497: CTR_7261Help
Entry
CTR_7261          CDS       T01707                                 

Gene name
pgmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cty  Chlamydia trachomatis A2497
Pathway
cty00010  Glycolysis / Gluconeogenesis
cty00260  Glycine, serine and threonine metabolism
cty00680  Methane metabolism
cty01100  Metabolic pathways
cty01110  Biosynthesis of secondary metabolites
cty01120  Microbial metabolism in diverse environments
cty01130  Biosynthesis of antibiotics
cty01200  Carbon metabolism
cty01230  Biosynthesis of amino acids
Module
cty_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cty00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTR_7261 (pgmA)
  Energy metabolism
   00680 Methane metabolism
    CTR_7261 (pgmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTR_7261 (pgmA)
Enzymes [BR:cty01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CTR_7261 (pgmA)
Membrane trafficking [BR:cty04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CTR_7261 (pgmA)
Exosome [BR:cty04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CTR_7261 (pgmA)
  Exosomal proteins of melanoma cells
   CTR_7261 (pgmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAX09394
Position
complement(836459..837139)
Genome map
AA seq 226 aa AA seqDB search
MTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLVRSL
ITALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQGKNK
QEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFISAHG
NSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcttatcttgctacgccatggccaatccgtatggaatcaaaaaaatctgttt
acaggctgggtagacatccctcttagccaacaaggaattcaagaggctattgccgctgga
gaatctattaaacatcttcctattgattgcatcttcacttccaccttggttagaagtttg
ataacagccctgttagcaatgactaaccacagctctcaaaaagttccttatatcgttcat
gaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcagatgatccct
ctttttcaatctagcgctctcaatgaacgcatgtacggagaacttcaaggaaaaaataaa
caagaagtcgctgctcaattcggagaagaacaggtaaaactgtggcgccgaagctaccgc
attgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctcccctatttt
caagagagaattttccctctccttcagcaagggaaaaatatttttatctctgctcacggg
aattctttgcgctccttaattatggacctagaaaaattatctgaagaacaagtactctct
ttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaattcacgaaa
cacgctccttctcttggttaa

DBGET integrated database retrieval system