KEGG   Chlamydia trachomatis B/TZ1A828/OT: CTB_0541Help
Entry
CTB_0541          CDS       T01327                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ctz  Chlamydia trachomatis B/TZ1A828/OT
Pathway
ctz00020  Citrate cycle (TCA cycle)
ctz00310  Lysine degradation
ctz01100  Metabolic pathways
ctz01110  Biosynthesis of secondary metabolites
ctz01120  Microbial metabolism in diverse environments
ctz01130  Biosynthesis of antibiotics
ctz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTB_0541 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CTB_0541 (sucB)
Enzymes [BR:ctz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CTB_0541 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl RnfC_N
Motif
Other DBs
NCBI-ProteinID: CAX09608
Position
64209..65306
Genome map
AA seq 365 aa AA seqDB search
MSIEVRIPNIAESISEVTISALLIPSGDLVQENQGILEIESDKVNQLIYAPCSGKVEWSV
SVGDTVAVGSVVGIISEAEKSQDTAPIHEQMPFSLVEQESDAQIIAFPSSVRQDPPAEGK
TFVPLKEIQPASSDHRESRESMSAIRKTISRRLVQSLHDSAMLTTFNEIHMGPLIALRKE
RQEDFIAKYGVKLGFMSFFVRAVVDSLKKYPRVNAYIEDNEIVYRHYYDISIAIGTDRGL
VVPVIRNCDQLSSGEIELQLADLASRAREGKLAIHELEGGGFTITNGGVYGSLLSTPIIN
PPQVGILGMHKIEKRPVVREDAIVIADMMYVAMSYDHRIIDGKEAVGFLVNVKEQLEQPE
LLLKM
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagaggttcgtattcccaatatcgcagaatctattagtgaagtgacgatttct
gcacttttgattccatcaggagatttggtgcaggagaatcaagggattctggagatagag
agtgacaaggtgaatcagctcatttacgctccttgctcaggaaaggtagagtggagcgtt
tccgtaggagatacggtcgctgttggtagtgttgtagggattattagtgaagcggaaaag
agtcaagatactgcacctatccatgagcagatgccatttagtcttgtagagcaggaaagc
gatgcgcagattattgccttcccttcatcagtgagacaggatcctcctgcagaagggaaa
acttttgttccattaaaggagatccaaccagcttcttctgatcatagagaatctcgagaa
tctatgagtgctattcggaagacgatttctcgtagattggtgcaatctctacatgattca
gcaatgttaacgacatttaatgaaatccatatggggccgcttattgctctgcgtaaggaa
agacaagaagatttcattgcgaagtatggggtaaaacttgggttcatgtctttctttgtt
agagccgttgtagattctttgaaaaaatatccccgggtgaatgcttatattgaagataac
gaaatcgtttacagacattactacgatatttccattgccatagggacagatcgtggatta
gtagttcctgtaattcgtaattgtgatcagttatctagcggggagattgagttacagctt
gccgatttagcttctcgtgctcgggaaggcaaacttgctattcatgagttagaaggggga
ggcttcactattaccaatggaggggtatatggttctcttctatccactcccattatcaat
cctccacaggtaggtattcttgggatgcataagatagagaaacgccctgtggttagagaa
gatgcaattgtgatagccgatatgatgtatgtagctatgagctatgatcatcggattata
gacggaaaggaagccgtaggattccttgtgaatgttaaagagcaattagaacaacccgag
cttttgctaaaaatgtag

DBGET integrated database retrieval system