KEGG   Chlamydia trachomatis B/TZ1A828/OT: CTB_0861Help
Entry
CTB_0861          CDS       T01327                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ctz  Chlamydia trachomatis B/TZ1A828/OT
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CTB_0861 (malQ)
Enzymes [BR:ctz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CTB_0861 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(100585..102168)
Genome map
AA seq 527 aa AA seqDB search
MPSLSQSRRIIQQSSIRKIWNQIDTSPKHGVCVPLFSLHTQESCGIGEFLDLIPMIDWCI
SCGFQILQILPINDTGSCSSPYNSISSIALNPLHLSISALPYKEEVPAAETRIREMQQLS
QLPQVHYEKVRSMKRDFFQEYYRVCKQKKLTDHPDFYAFCEQEKYWLHPYALFRSIREHL
DNLPINHWPTTYTDLSQITEHERTFAEDIQFHSYLQYLCFQQMTQVREHANCKSCLIKGD
IPILISKDSCDVWFYRHYFSSSESVGAPPDLYNAEGQNWHLPIYNMKTLQQDNYLWWKER
LRYAENFYSLYRLDHVVGLFRFWVWDESGCGRFEPHDPKNYLAQGQDILSHLLTSSSMLP
IGEDLGTIPSDVKRMLESFAVCGTRIPRWERNWEGNGAYTPFDQYDPLSVTSLSTHDSST
LASWWKESPQESKLFAQFLGLPYSSTLSLHNHTEILKLSHKTSSIFRINLINDYLALFPD
LISKTPRYERINLPGTISKNNWVYRVKPSIEDLSSHSKLNSLLEALF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgccatcattatcccaatcccgacgtatcatccagcaatcttccattcgaaagatttgg
aatcagatagatacttctcctaagcatggcgtatgtgtaccgttattttctctccatact
caagaaagttgtgggataggtgaatttcttgacctgattcctatgatcgattggtgtatc
tcgtgtggttttcaaatccttcaaattcttccgattaacgatacagggtcctgttcgagt
ccttacaatagcatttcttcgatagcactcaatcctcttcacctttctatctctgcgctc
ccctataaagaagaagtgccagctgcggaaacacgcatacgagaaatgcagcaactctct
caacttcctcaagtacattatgaaaaagttcgctctatgaagagagatttttttcaagag
tactaccgcgtgtgtaaacagaaaaaactcactgatcatcctgatttttatgccttctgt
gaacaggaaaaatattggttacatccctacgctctctttcgctctatccgagaacatttg
gataaccttcctattaatcattggccaaccacctacacagatctctcccagattaccgag
catgaacgtacttttgcggaagatatacaatttcactcttatctacagtatttgtgcttc
caacagatgacacaagtgcgggagcatgccaattgcaaaagctgtctcatcaaaggggat
atccctattctaatcagtaaagatagctgcgatgtctggttttataggcattacttttcc
tcttcagaatctgtaggtgctcctcctgacctgtataatgcggaaggtcagaactggcat
ctccccatttataatatgaaaactttgcaacaagataactacctctggtggaaggagcgc
ttacgttatgcggagaatttttactctttataccgtcttgatcatgtcgtcggtctcttt
cgattttgggtatgggatgagtctggatgcggacgctttgaacctcatgatccgaaaaac
tatctagctcaagggcaagatatcttatctcacctcttgaccagttcatctatgctacct
ataggagaagatctgggaacgatcccttccgatgtgaaacgtatgctcgagtcttttgcc
gtatgcggcactagaattcctcgttgggaacgaaactgggaagggaatggagcctatacc
cctttcgatcaatacgaccctctatccgtcacaagcctctctactcatgattcctctaca
ttagcctcatggtggaaagaatctcctcaggaatccaaactatttgctcagtttttagga
ctcccctattcttccaccctatctcttcacaatcataccgaaatcctgaaactctctcac
aaaacctcttctatttttcgcatcaatcttattaatgactatctggctctgttcccggat
ttgatatcaaaaactcctcgctacgaaagaatcaatctgccaggaactatttcaaaaaat
aattgggtgtatcgagttaagccttctattgaagatttatcctctcattctaagctaaat
tctttacttgaggctctattttag

DBGET integrated database retrieval system