KEGG   Chlamydia trachomatis B/TZ1A828/OT: CTB_1651Help
Entry
CTB_1651          CDS       T01327                                 

Gene name
trpA
Definition
Tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ctz  Chlamydia trachomatis B/TZ1A828/OT
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTB_1651 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTB_1651 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTB_1651 (trpA)
Enzymes [BR:ctz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTB_1651 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
196193..196951
Genome map
AA seq 252 aa AA seqDB search
MSKLTQVFKQTKPCIGYLTAGDGGTSYTIEAAKALIQGGVDILELGFPFSDPVADNPEIQ
VSHDRALAENLTSETLLEIVEGIRAFNQEVPLILYSYYNPLLQRDLDYLRRLKDAGINGV
CVIDLPAPLSHGEKSPFEDLLAVGLDPILLISAGTTPERMSLIQEHARGLLYYIPYQATR
DSEVGIKEEFRKVREHFDLPIVDRRDICDKKEAAHVLNYSDGFIVKTAFVHQTTMDSSVE
TLTALAQTVIPG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaacccaagtttttaaacaaactaagccatgtattggctatctaaccgct
ggtgatggcggtactagttatactattgaggcggcaaaagctctgattcaaggaggtgtc
gatattctggaactaggatttcctttttctgatcctgttgcagataatccagaaattcaa
gtatctcatgatcgggctttagcagaaaatctgacgtcagaaactttgttagagatcgta
gaaggtatccgagcttttaatcaagaagtcccattgatcttatatagctactacaatccg
cttctacaaagggacttagattatctacgcagactaaaagacgcgggaataaatggtgtg
tgcgttatagatcttccagcacctttatcacacggagaaaaatctccttttgaagatctt
ttagctgtaggattggatcctattttgcttatttctgcagggacaactccggagcggatg
tctttaatacaagaacacgcaagaggccttctgtattatatcccataccaagctacgaga
gattctgaagtaggtatcaaagaagaatttcgaaaagtcagagaacattttgatcttcca
attgtagatagaagagatatttgtgataaaaaagaagctgcacatgtgctgaattattca
gatggtttcattgtgaaaacagcgtttgttcatcagacaacaatggattcttcggtagag
actctgactgcacttgcacaaacagttattcctggataa

DBGET integrated database retrieval system