KEGG   Chlamydia trachomatis B/TZ1A828/OT: CTB_1651Help
Entry
CTB_1651          CDS       T01327                                 

Gene name
trpA
Definition
Tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ctz  Chlamydia trachomatis B/TZ1A828/OT
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ctz01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ctz00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ctz00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
196193..196951
Genome map
AA seq 252 aa AA seqDB search
MSKLTQVFKQTKPCIGYLTAGDGGTSYTIEAAKALIQGGVDILELGFPFSDPVADNPEIQ
VSHDRALAENLTSETLLEIVEGIRAFNQEVPLILYSYYNPLLQRDLDYLRRLKDAGINGV
CVIDLPAPLSHGEKSPFEDLLAVGLDPILLISAGTTPERMSLIQEHARGLLYYIPYQATR
DSEVGIKEEFRKVREHFDLPIVDRRDICDKKEAAHVLNYSDGFIVKTAFVHQTTMDSSVE
TLTALAQTVIPG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaacccaagtttttaaacaaactaagccatgtattggctatctaaccgct
ggtgatggcggtactagttatactattgaggcggcaaaagctctgattcaaggaggtgtc
gatattctggaactaggatttcctttttctgatcctgttgcagataatccagaaattcaa
gtatctcatgatcgggctttagcagaaaatctgacgtcagaaactttgttagagatcgta
gaaggtatccgagcttttaatcaagaagtcccattgatcttatatagctactacaatccg
cttctacaaagggacttagattatctacgcagactaaaagacgcgggaataaatggtgtg
tgcgttatagatcttccagcacctttatcacacggagaaaaatctccttttgaagatctt
ttagctgtaggattggatcctattttgcttatttctgcagggacaactccggagcggatg
tctttaatacaagaacacgcaagaggccttctgtattatatcccataccaagctacgaga
gattctgaagtaggtatcaaagaagaatttcgaaaagtcagagaacattttgatcttcca
attgtagatagaagagatatttgtgataaaaaagaagctgcacatgtgctgaattattca
gatggtttcattgtgaaaacagcgtttgttcatcagacaacaatggattcttcggtagag
actctgactgcacttgcacaaacagttattcctggataa

DBGET integrated database retrieval system