KEGG   Chlamydia trachomatis B/TZ1A828/OT: CTB_1651Help
Entry
CTB_1651          CDS       T01327                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ctz  Chlamydia trachomatis B/TZ1A828/OT
Pathway
ctz00260  Glycine, serine and threonine metabolism
ctz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ctz01100  Metabolic pathways
ctz01110  Biosynthesis of secondary metabolites
ctz01130  Biosynthesis of antibiotics
ctz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTB_1651 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTB_1651 (trpA)
Enzymes [BR:ctz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTB_1651 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: CAX09725
Position
196193..196951
Genome map
AA seq 252 aa AA seqDB search
MSKLTQVFKQTKPCIGYLTAGDGGTSYTIEAAKALIQGGVDILELGFPFSDPVADNPEIQ
VSHDRALAENLTSETLLEIVEGIRAFNQEVPLILYSYYNPLLQRDLDYLRRLKDAGINGV
CVIDLPAPLSHGEKSPFEDLLAVGLDPILLISAGTTPERMSLIQEHARGLLYYIPYQATR
DSEVGIKEEFRKVREHFDLPIVDRRDICDKKEAAHVLNYSDGFIVKTAFVHQTTMDSSVE
TLTALAQTVIPG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaacccaagtttttaaacaaactaagccatgtattggctatctaaccgct
ggtgatggcggtactagttatactattgaggcggcaaaagctctgattcaaggaggtgtc
gatattctggaactaggatttcctttttctgatcctgttgcagataatccagaaattcaa
gtatctcatgatcgggctttagcagaaaatctgacgtcagaaactttgttagagatcgta
gaaggtatccgagcttttaatcaagaagtcccattgatcttatatagctactacaatccg
cttctacaaagggacttagattatctacgcagactaaaagacgcgggaataaatggtgtg
tgcgttatagatcttccagcacctttatcacacggagaaaaatctccttttgaagatctt
ttagctgtaggattggatcctattttgcttatttctgcagggacaactccggagcggatg
tctttaatacaagaacacgcaagaggccttctgtattatatcccataccaagctacgaga
gattctgaagtaggtatcaaagaagaatttcgaaaagtcagagaacattttgatcttcca
attgtagatagaagagatatttgtgataaaaaagaagctgcacatgtgctgaattattca
gatggtttcattgtgaaaacagcgtttgttcatcagacaacaatggattcttcggtagag
actctgactgcacttgcacaaacagttattcctggataa

DBGET integrated database retrieval system