KEGG   Chlamydia trachomatis B/TZ1A828/OT: CTB_2021Help
Entry
CTB_2021          CDS       T01327                                 

Gene name
gseA
Definition
3-deoxy-D-manno-octulosonic-acid transferase
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
ctz  Chlamydia trachomatis B/TZ1A828/OT
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctz00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CTB_2021 (gseA)
Enzymes [BR:ctz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.12  lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     CTB_2021 (gseA)
    2.4.99.13  (Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     CTB_2021 (gseA)
    2.4.99.14  (Kdo)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase
     CTB_2021 (gseA)
    2.4.99.15  (Kdo)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase
     CTB_2021 (gseA)
Glycosyltransferases [BR:ctz01003]
 Polysaccharide
  Bacterial polysaccharide
   CTB_2021 (gseA)
Lipopolysaccharide biosynthesis proteins [BR:ctz01005]
 Core region
  CTB_2021 (gseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(236578..237873)
Genome map
AA seq 431 aa AA seqDB search
MIRRWLTSRLYDAFLVCAFFVSAPRIFYKVFFHGKYIDSWKIRFGVQKPFVKGEGPLVWF
HGASVGEVSLLAPLLNRWREEFPEWRFVVTTCSEAGVHTARRLYESLGATVFVLPLDLSC
IIKSVVRKLAPDIVIFSEGDCWLHFLTESKRLGAKAFLINGKLSEHSCKRFSFLKRLGRN
YFAPLDLLILQDELYKQRFMQIGISSDKIHVTGNMKTFIESSLATNRRDFWRAKLQISSQ
DRLIVLGSVHPKDVEVWAEVVSHFHNSSTKILWVPRHLEKLKEHAKLLEKAGILFGLWSQ
GASFRQYNSLIMDAMGVLKDIYSAADIAFVGGTFDPSVGGHNLLEPLQKEVPLMFGPYIY
SQSVLAEKLREKEAGLSVNKETLLDVVTDLLQNEKNRQAYIEKGKSFLKQEENSFQQTWE
ILKSQITCMKI
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgataagacgttggttaacatctcgtctctatgatgcgtttttagtttgcgcttttttt
gtttcggcgccacgtattttttacaaagtgtttttccatgggaaatatattgactcttgg
aaaattcggtttggggtacagaaaccttttgtgaagggggaaggccctttagtttggttt
catggagcttctgtgggggaagtcagtctgttggctccccttcttaatcgatggagagaa
gagtttccagaatggcggtttgttgttacaacgtgttctgaagctggtgtgcacaccgct
cgtcgtttgtatgaatctcttggcgctactgtatttgttttacctctggatttaagttgt
attattaaatccgtggttcgcaagcttgctcctgatatcgtgatcttttcagaaggagac
tgttggttacattttttgacagaatccaaacgtttaggggcaaaagcctttttgattaat
ggcaaactttcggaacattcttgtaagcgtttttcttttttaaagcggttaggaaggaat
tattttgctccgttagatttattgatactacaagacgagctgtataaacaacggtttatg
cagataggtatttcctcggataagattcatgtcactggaaacatgaaaacgtttatagaa
tcctctcttgccacaaatcgccgagatttttggagagcaaaattacaaatatcttctcag
gatcgcttaattgtattgggttctgtgcatcctaaagatgtagaggtatgggctgaagtg
gtttcacatttccacaattcttctacaaaaattttatgggttcctagacatcttgagaag
ttaaaggagcatgctaagctactagaaaaggctgggattttatttggattatggagtcaa
ggtgcttctttccggcagtataattctttaattatggacgctatgggggtattaaaagat
atttactctgcagcagatattgcatttgtaggaggaactttcgatccatctgtaggaggg
cataatttattagagcctcttcaaaaagaggtgcctcttatgtttggaccctatatttat
tctcaatctgttcttgctgaaaagttgcgggaaaaagaagcaggactttctgtgaacaaa
gaaactcttttagatgtagttacagatcttcttcaaaacgaaaaaaaccgccaagcttat
attgaaaaggggaaatcttttttgaagcaggaagaaaatagctttcaacagacatgggaa
atattaaagagccaaattacttgcatgaaaatctaa

DBGET integrated database retrieval system