KEGG   Chlamydia trachomatis B/TZ1A828/OT: CTB_5391Help
Entry
CTB_5391          CDS       T01327                                 

Gene name
dnaQ2
Definition
DNA polymerase III subunit epsilon
Orthology
K02342  
DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
ctz  Chlamydia trachomatis B/TZ1A828/OT
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CTB_5391 (dnaQ2)
   00240 Pyrimidine metabolism
    CTB_5391 (dnaQ2)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CTB_5391 (dnaQ2)
   03430 Mismatch repair
    CTB_5391 (dnaQ2)
   03440 Homologous recombination
    CTB_5391 (dnaQ2)
Enzymes [BR:ctz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CTB_5391 (dnaQ2)
DNA replication proteins [BR:ctz03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CTB_5391 (dnaQ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(605901..606653)
Genome map
AA seq 250 aa AA seqDB search
MVLLKDVEFVCLDCETTGLDVKKDRVIEFAAIRFTFDEIIDSVEFLIHPERAVSAESQKI
HKISDAMLRDKPKFGEVFSRIKGFFKERDHIVGHHVGFDLQVLSQESERLGETLLPKHHY
VIDTLRLAKEYGDSPNNSLEALARHFNVPHQGNHRAMKDVEMNVKVFKHLTKRFRTLSQV
THILSKPIKMKYMPLGKYKGRLFTDIPLEYLLWASKMDFDQDLLFSICSEIKSRKKGTGF
AQANNPFLGL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtggtactattgaaggatgttgagttcgtttgtttagattgtgaaacaacgggattggat
gtaaaaaaggatcgcgtgattgaatttgctgcaatccggtttacatttgatgaaattatt
gattcagtagagtttcttattcatccggagcgagctgtttcagcagaatctcaaaagatt
cataagatttctgatgccatgttaagggataagccaaagtttggtgaggtgttctctaga
attaagggtttctttaaggaaagagatcatatcgtcgggcaccatgtaggatttgatcta
caagttctttcccaggaaagcgaacgtttaggggaaactctgcttcctaagcatcattat
gtgatagatactttacgtctagctaaagagtatggagatagtccgaataattctttagaa
gctttagcaaggcatttcaatgttcctcatcaaggaaatcatcgagctatgaaagatgtg
gaaatgaatgttaaggtattcaaacacttaactaagcggttccgtacgctgtcgcaggtg
acacacattttgtctaagcctattaaaatgaaatacatgccgttagggaagtataaaggg
cggttgtttacagatattccattagaatatctactgtgggcttcaaaaatggattttgac
caagatctacttttttctatctgtagtgagatcaaatcacggaaaaagggtaccggattt
gctcaggcaaacaacccatttttaggattgtaa

DBGET integrated database retrieval system