KEGG   Chlamydia trachomatis B/TZ1A828/OT: CTB_7271Help
Entry
CTB_7271          CDS       T01327                                 

Gene name
pgmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctz  Chlamydia trachomatis B/TZ1A828/OT
Pathway
ctz00010  Glycolysis / Gluconeogenesis
ctz00260  Glycine, serine and threonine metabolism
ctz00680  Methane metabolism
ctz01100  Metabolic pathways
ctz01110  Biosynthesis of secondary metabolites
ctz01120  Microbial metabolism in diverse environments
ctz01130  Biosynthesis of antibiotics
ctz01200  Carbon metabolism
ctz01230  Biosynthesis of amino acids
Module
ctz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTB_7271 (pgmA)
  Energy metabolism
   00680 Methane metabolism
    CTB_7271 (pgmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTB_7271 (pgmA)
Enzymes [BR:ctz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CTB_7271 (pgmA)
Membrane trafficking [BR:ctz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CTB_7271 (pgmA)
Exosome [BR:ctz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CTB_7271 (pgmA)
  Exosomal proteins of melanoma cells
   CTB_7271 (pgmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAX10288
Position
complement(836416..837096)
Genome map
AA seq 226 aa AA seqDB search
MTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLVRSL
ITALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQGKNK
QEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFISAHG
NSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcttatcttgctacgccatggccaatccgtatggaatcaaaaaaatctgttt
acaggctgggtagacatccctcttagccaacaaggaattcaagaggctattgccgctgga
gaatctattaaacatcttcctattgattgcatcttcacttccaccttggttagaagtttg
ataacagccctgttagcaatgactaaccacagctctcaaaaagttccttatatcgttcat
gaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcagatgatccct
ctttttcaatctagcgctctcaatgaacgcatgtacggagaacttcaaggaaaaaataaa
caagaagtcgctgctcaattcggagaagaacaggtaaaactgtggcgccgaagctaccgc
attgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctcccctatttt
caagagagaattttccctctccttcagcaagggaaaaatatttttatctctgctcacggg
aattctttgcgctccttaattatggacctagaaaaattatctgaagaacaagtactctct
ttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaattcacgaaa
cacgctccttctcttggttaa

DBGET integrated database retrieval system