KEGG   Corynebacterium urealyticum DSM 7111: CU7111_0198Help
Entry
CU7111_0198       CDS       T02457                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cua  Corynebacterium urealyticum DSM 7111
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cua00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CU7111_0198 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CU7111_0198 (aceA)
Enzymes [BR:cua01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CU7111_0198 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(246609..247901)
Genome map
AA seq 430 aa AA seqDB search
MSTVGTPRTAAEIQKDWDENPRWAQVKRDYTAEQVAELQGNVLEEHTLARRGAEILWEAV
NKGDDSYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
NVVQRINNALMRADEIARVEGDDSVENWLVPIVADGEAGFGGALNVYELQKAMIKAGAAG
SHWEDQLASEKKCGHLGGKVLIPTQQHVRTLNAARLAADVANTPTLVVARTDAEAATLLT
SDVDDRDKPFLTGGRTAEGFYNVQNGIEPCIARAKAYAPYADLIWMETGTPDLELAKKFA
EAVHEEYPDQLLAYNCSPSFNWSAHLEADEIAKFQNELGAMGFKFQFITLAGFHALNYSM
FDLAYGYAREQMTAFVDLQNREFKAAEERGFTAVKHQREVGAGYFDAIATTVDPNSSTTA
LKGSTEEGQF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactgtcggaactccacgtaccgcagctgaaatccagaaggactgggacgagaac
ccgcgctgggcacaggtcaagcgtgactacaccgctgagcaggtcgcagagctccagggc
aacgtcctcgaggagcacaccctcgcacgccgcggcgctgagatcctctgggaggccgtc
aacaagggcgacgactcctacatcaacgccctcggcgcactgaccggcaaccaggccgtc
cagcaggtccgcgcaggcctgaaggctgtctacctctccggttggcaggtcgcaggtgac
gccaacctttctggccacacctacccggaccagtccctgtacccggctaactccgtgccg
aacgttgttcagcgcatcaacaacgctctgatgcgcgccgacgagatcgctcgcgtcgag
ggcgatgactccgtcgagaactggctcgtcccgatcgtcgctgacggtgaggccggcttc
ggtggcgctctgaacgtctacgagctgcagaaggccatgatcaaggctggcgccgctggc
tcccactgggaggaccagctcgcttccgagaagaagtgtggccacctgggcggcaaggtc
ctgatcccgacccagcagcacgttcgtaccctgaacgctgctcgtctggcagctgacgtt
gctaacaccccgaccctggtcgtcgcacgtaccgacgccgaggctgcaaccctgctgacc
tccgacgtcgatgaccgcgacaagccgttcctgaccggcggccgtaccgctgagggcttc
tacaacgtccagaacggcatcgagccatgcatcgctcgtgcgaaggcatacgctccgtac
gctgacctcatctggatggagaccggcaccccggacctcgagctggctaagaagttcgcc
gaggcggtccacgaggagtacccagaccagctgctggcctacaactgctccccgtccttc
aactggtccgcacacctcgaggcagacgagatcgccaagttccagaacgagctgggcgca
atgggcttcaagttccagttcatcaccctggctggcttccacgccctgaactactccatg
ttcgacctggcttacggctacgctcgcgagcagatgaccgcattcgtcgacctgcagaac
cgcgagttcaaggctgccgaggagcgcggcttcaccgccgtcaagcaccagcgcgaggtc
ggtgcaggctacttcgacgccatcgcaaccaccgtcgacccgaactcctccaccaccgcc
ctgaagggctccaccgaggagggccagttctaa

DBGET integrated database retrieval system