KEGG   Corynebacterium urealyticum DSM 7111: CU7111_1147Help
Entry
CU7111_1147       CDS       T02457                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cua  Corynebacterium urealyticum DSM 7111
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cua01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cua00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1362721..1363542)
Genome map
AA seq 273 aa AA seqDB search
MATVLDEIIAGVLEDQARREAEVPLAEIKARALDAPPPLDALAALSGPDVSVIAEVKRSS
PSKGALAAIPEPEVLAKAYAKNGAAVISCLTEERRFNGSLADFDAVRANVDIPLLRKDFI
VNPYQIYEARAHGADVILLIVAALEQERLTGLLDCAESLGMTALVEVHTEDEIERAVAAG
AKVIGVNARNLKTLEVDMSVFGRIAPLIPDHIVKIAESGVRDKHDLIEYARHGANAVLVG
EGLVTADDPGAAAKALVVAGQHPACPTGSKQDA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagtgttggatgagatcatcgccggagttctcgaggaccaggctcgccgtgaa
gcggaggtgccgctggcggagatcaaggcccgtgcactggacgccccgcccccgctcgac
gcgctggctgctctctccggtccggatgtgagcgttatcgctgaggtcaagcgctccagc
ccctcgaagggagcgctggccgcgatcccggagccggaggtgctggccaaggcctatgcc
aagaacggtgccgccgtcatcagctgcctgaccgaggagcgtcgcttcaacggctccctg
gccgacttcgatgcggtgcgtgcgaacgtggatatcccgctgctgcgtaaggatttcatc
gtcaacccgtaccagatctatgaggcccgggcgcatggcgcggacgtcattctcctcatc
gttgcagccctcgagcaggagcggctgaccgggctgctggactgcgccgagtcgctgggg
atgaccgccctcgtcgaggtgcacaccgaggatgagattgagcgcgcggtcgctgctggt
gccaaggtcattggcgtcaacgcccgcaacctcaagaccctcgaggtcgatatgtccgtc
ttcggtcgcatcgccccgctgatcccggatcacatcgtgaagatcgcggaatccggtgtg
cgggataagcacgacctgatcgagtacgcccgccacggcgcgaacgccgtcctcgtgggc
gagggactcgtcaccgccgacgacccgggtgcggccgccaaggccctcgtggtggcaggc
cagcacccggcgtgcccgaccggctccaagcaagacgcataa

DBGET integrated database retrieval system