KEGG   Corynebacterium urealyticum DSM 7111: CU7111_1299Help
Entry
CU7111_1299       CDS       T02457                                 

Gene name
choE
Definition
putative cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cua  Corynebacterium urealyticum DSM 7111
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1545739..1547466
Genome map
AA seq 575 aa AA seqDB search
MTATHYDVLIIGSGFGGSVTALRLVEKGYKVGVLEAGKRYADKDFAKNSWHLKQFLWAPV
IGCYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYQPEDEYFRNKQWAHITDWKDELTPY
YDQARRMLGVVTNPTMTPADKLSKQTAEELGVGDTFRMAPVGVFFGEKVGLNGKPKQTVE
DPYFGGAGPQRTACHECGECMTGCRHGAKNTLLKNYLYLAEKGGAEVHPLTTVTDITRKP
GGGWNVDTKTTGGLLGKKKTRRFTADKVVVAAGAWGTQNLLHRQKINGNLPQLPDSLGTM
TRTNSEALLGAQFKKYDPEWDFSEGVAITSSYFPAPDTHIEPVRYGKGSNSMGLLQTLMT
DGDKLRPRVLEFLRQLVLQFRQIPRLVNLRRWSQRTVINLVMQSRDNSLTTYPRTLGKFT
WLTSKQGTGEPNPSWIPEGNKATRILASLRKGGLAGGVWSEVVDIPLTAHFLGGCSISSS
PADGVVDPYHRVWGLPDLFVVDGSSMAANPGVNPSLSITANAERAAAMWPNKGEEDPRPE
QSEGYQRIEAVEPASPMVPATAPAALRLPITPVGN
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaacccactacgacgtcctcatcatcggctccggcttcggcggctccgtcacc
gccctacgcctcgtcgagaagggatacaaggtcggtgtcctcgaggccggcaagcgctac
gcggacaaggacttcgcgaagaactcctggcacctcaagcagttcctctgggcacccgtg
atcggctgctacggcatccagcgcatccacctgctgcgcaacgtcatgatcctcgccggc
gccggtgtcggcggcggttcgctgaactacgccaacaccctctaccagcccgaggacgag
tacttccgcaataagcagtgggcacacatcaccgactggaaggacgagctgaccccctac
tacgaccaggcacgccgcatgctgggtgtggtcaccaaccccaccatgaccccggcggac
aaactctcgaagcagaccgccgaggaactcggcgtgggcgataccttccgcatggctccg
gtgggcgtattcttcggcgaaaaggtggggctgaacggcaagccgaaacagaccgtggag
gacccctacttcggtggcgcaggcccgcagcgcaccgcctgccacgagtgcggcgagtgc
atgaccggctgccgccacggggcgaagaacaccctgctgaagaactacctctacctcgcc
gagaagggcggggccgaggtccacccgctgaccacggtcaccgacatcacccgcaaaccg
ggcggcggctggaacgtggatacgaagaccacgggaggcctgctgggcaagaagaagacc
cgccgattcaccgcggacaaggtcgtcgtcgccgcgggtgcgtggggcacccagaaccta
ctgcaccggcagaagatcaacggcaacctaccgcagctgccggactccctcggcacgatg
acccgcaccaactccgaggccctgctcggcgcgcagttcaaaaagtacgacccggagtgg
gatttctccgagggcgtggccatcacctccagctacttccccgccccggatacccacatt
gaaccagtccgctacggcaagggctcgaactccatgggcctgctgcagaccctcatgacc
gacggcgacaaactgcgcccccgcgtgctcgagttcctccgccagctggttctccagttc
cgccagatccctcgcctggtgaacctgcgccgctggtcgcagcgcacggtgatcaacctg
gtgatgcagtcccgcgataactcgctgaccacctacccgcgcacgctcgggaagttcacc
tggctgacctccaagcagggcaccggcgagccgaaccccagctggatcccggagggcaat
aaggccacccgcatcctggcctccctgcgcaagggtggcctggcaggcggggtgtggtcc
gaggtggtcgacatccccctgaccgcccacttcctcggcggttgttcaatctccagctcc
ccggccgacggcgtggtggacccctatcaccgcgtgtgggggctgccggatctattcgtg
gtcgacggctcgtccatggccgccaaccccggcgtgaacccttctctgtccatcaccgcc
aacgcggagcgcgccgctgcgatgtggccgaataagggcgaggaggacccgcggccggag
cagtccgagggctatcagcgcatcgaggccgtggagccggcctccccgatggttcctgcc
accgccccggccgcgctgcgcctgccgatcaccccggtgggcaactag

DBGET integrated database retrieval system