KEGG   Corynebacterium urealyticum DSM 7111: CU7111_1299Help
Entry
CU7111_1299       CDS       T02457                                 

Gene name
choE
Definition
(GenBank) putative cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
cua  Corynebacterium urealyticum DSM 7111
Pathway
cua01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cua00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    CU7111_1299 (choE)
Enzymes [BR:cua01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     CU7111_1299 (choE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 HI0933_like FAD_binding_3 Fer4_9 Mqo Pyr_redox Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AGE36888
Position
1545739..1547466
Genome map
AA seq 575 aa AA seqDB search
MTATHYDVLIIGSGFGGSVTALRLVEKGYKVGVLEAGKRYADKDFAKNSWHLKQFLWAPV
IGCYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYQPEDEYFRNKQWAHITDWKDELTPY
YDQARRMLGVVTNPTMTPADKLSKQTAEELGVGDTFRMAPVGVFFGEKVGLNGKPKQTVE
DPYFGGAGPQRTACHECGECMTGCRHGAKNTLLKNYLYLAEKGGAEVHPLTTVTDITRKP
GGGWNVDTKTTGGLLGKKKTRRFTADKVVVAAGAWGTQNLLHRQKINGNLPQLPDSLGTM
TRTNSEALLGAQFKKYDPEWDFSEGVAITSSYFPAPDTHIEPVRYGKGSNSMGLLQTLMT
DGDKLRPRVLEFLRQLVLQFRQIPRLVNLRRWSQRTVINLVMQSRDNSLTTYPRTLGKFT
WLTSKQGTGEPNPSWIPEGNKATRILASLRKGGLAGGVWSEVVDIPLTAHFLGGCSISSS
PADGVVDPYHRVWGLPDLFVVDGSSMAANPGVNPSLSITANAERAAAMWPNKGEEDPRPE
QSEGYQRIEAVEPASPMVPATAPAALRLPITPVGN
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaacccactacgacgtcctcatcatcggctccggcttcggcggctccgtcacc
gccctacgcctcgtcgagaagggatacaaggtcggtgtcctcgaggccggcaagcgctac
gcggacaaggacttcgcgaagaactcctggcacctcaagcagttcctctgggcacccgtg
atcggctgctacggcatccagcgcatccacctgctgcgcaacgtcatgatcctcgccggc
gccggtgtcggcggcggttcgctgaactacgccaacaccctctaccagcccgaggacgag
tacttccgcaataagcagtgggcacacatcaccgactggaaggacgagctgaccccctac
tacgaccaggcacgccgcatgctgggtgtggtcaccaaccccaccatgaccccggcggac
aaactctcgaagcagaccgccgaggaactcggcgtgggcgataccttccgcatggctccg
gtgggcgtattcttcggcgaaaaggtggggctgaacggcaagccgaaacagaccgtggag
gacccctacttcggtggcgcaggcccgcagcgcaccgcctgccacgagtgcggcgagtgc
atgaccggctgccgccacggggcgaagaacaccctgctgaagaactacctctacctcgcc
gagaagggcggggccgaggtccacccgctgaccacggtcaccgacatcacccgcaaaccg
ggcggcggctggaacgtggatacgaagaccacgggaggcctgctgggcaagaagaagacc
cgccgattcaccgcggacaaggtcgtcgtcgccgcgggtgcgtggggcacccagaaccta
ctgcaccggcagaagatcaacggcaacctaccgcagctgccggactccctcggcacgatg
acccgcaccaactccgaggccctgctcggcgcgcagttcaaaaagtacgacccggagtgg
gatttctccgagggcgtggccatcacctccagctacttccccgccccggatacccacatt
gaaccagtccgctacggcaagggctcgaactccatgggcctgctgcagaccctcatgacc
gacggcgacaaactgcgcccccgcgtgctcgagttcctccgccagctggttctccagttc
cgccagatccctcgcctggtgaacctgcgccgctggtcgcagcgcacggtgatcaacctg
gtgatgcagtcccgcgataactcgctgaccacctacccgcgcacgctcgggaagttcacc
tggctgacctccaagcagggcaccggcgagccgaaccccagctggatcccggagggcaat
aaggccacccgcatcctggcctccctgcgcaagggtggcctggcaggcggggtgtggtcc
gaggtggtcgacatccccctgaccgcccacttcctcggcggttgttcaatctccagctcc
ccggccgacggcgtggtggacccctatcaccgcgtgtgggggctgccggatctattcgtg
gtcgacggctcgtccatggccgccaaccccggcgtgaacccttctctgtccatcaccgcc
aacgcggagcgcgccgctgcgatgtggccgaataagggcgaggaggacccgcggccggag
cagtccgagggctatcagcgcatcgaggccgtggagccggcctccccgatggttcctgcc
accgccccggccgcgctgcgcctgccgatcaccccggtgggcaactag

DBGET integrated database retrieval system