KEGG   Corynebacterium urealyticum DSM 7111: CU7111_1470Help
Entry
CU7111_1470       CDS       T02457                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cua  Corynebacterium urealyticum DSM 7111
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cua00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cua00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1746382..1747071
Genome map
AA seq 229 aa AA seqDB search
MGVSEFGVQNKQRPSGYREGDYPTLTREDVPEGVEIAMIWAETTAGIIGDGAEMPWYLPE
DLKHFKNSTMGYPVVMGRTSWEALGKYRPLPGRENFVITRRADYSAPGGDVVASIKDGIA
AAAAFARGEGSGGEVPETASEALQDDGRVTVWILGGGQVYAQCMPIADRVVITEIDMVAP
ERFQVYAPAMDESDFTVERSEWFASDKGHPVDEEPNGLRYRFETWRRKA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgggagtttcggagtttggcgtccagaataaacagcgccccagtggttaccgcgagggc
gactaccccaccctgacccgggaggacgtcccggaaggggtggagatcgcgatgatctgg
gctgaaacaaccgccggcatcatcggcgatggggcggagatgccctggtatctgccggag
gacctgaagcactttaagaactccacgatgggttatccggtcgtgatgggccgcacgagc
tgggaggcgctgggcaagtaccgcccgctgccgggccgcgagaacttcgtcatcacccgt
agggccgactattcggctcccggtggtgacgtggtcgcttccattaaggacggcatcgca
gcggccgcggcatttgcccgcggagaagggtcgggcggcgaggtcccggagacggcgtcg
gaggcgctgcaggacgacggccgggtgaccgtatggatcctgggtgggggccaggtatac
gcgcagtgcatgccgatcgcggaccgggtggtgatcacggagatcgacatggttgctccg
gagcgtttccaggtttatgccccggcgatggatgagtcagattttacggtcgagcgttcc
gagtggttcgcatcggataagggccacccggtcgacgaggagccgaacgggttgcgctac
cgattcgagacgtggcgccggaaggcgtag

DBGET integrated database retrieval system