KEGG   Corynebacterium urealyticum DSM 7111: CU7111_1470Help
Entry
CU7111_1470       CDS       T02457                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cua  Corynebacterium urealyticum DSM 7111
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cua00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CU7111_1470 (folA)
   00670 One carbon pool by folate
    CU7111_1470 (folA)
Enzymes [BR:cua01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CU7111_1470 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1746382..1747071
Genome map
AA seq 229 aa AA seqDB search
MGVSEFGVQNKQRPSGYREGDYPTLTREDVPEGVEIAMIWAETTAGIIGDGAEMPWYLPE
DLKHFKNSTMGYPVVMGRTSWEALGKYRPLPGRENFVITRRADYSAPGGDVVASIKDGIA
AAAAFARGEGSGGEVPETASEALQDDGRVTVWILGGGQVYAQCMPIADRVVITEIDMVAP
ERFQVYAPAMDESDFTVERSEWFASDKGHPVDEEPNGLRYRFETWRRKA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgggagtttcggagtttggcgtccagaataaacagcgccccagtggttaccgcgagggc
gactaccccaccctgacccgggaggacgtcccggaaggggtggagatcgcgatgatctgg
gctgaaacaaccgccggcatcatcggcgatggggcggagatgccctggtatctgccggag
gacctgaagcactttaagaactccacgatgggttatccggtcgtgatgggccgcacgagc
tgggaggcgctgggcaagtaccgcccgctgccgggccgcgagaacttcgtcatcacccgt
agggccgactattcggctcccggtggtgacgtggtcgcttccattaaggacggcatcgca
gcggccgcggcatttgcccgcggagaagggtcgggcggcgaggtcccggagacggcgtcg
gaggcgctgcaggacgacggccgggtgaccgtatggatcctgggtgggggccaggtatac
gcgcagtgcatgccgatcgcggaccgggtggtgatcacggagatcgacatggttgctccg
gagcgtttccaggtttatgccccggcgatggatgagtcagattttacggtcgagcgttcc
gagtggttcgcatcggataagggccacccggtcgacgaggagccgaacgggttgcgctac
cgattcgagacgtggcgccggaaggcgtag

DBGET integrated database retrieval system