KEGG   Corynebacterium urealyticum DSM 7111: CU7111_1639Help
Entry
CU7111_1639       CDS       T02457                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cua  Corynebacterium urealyticum DSM 7111
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cua00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1937504..1938118)
Genome map
AA seq 204 aa AA seqDB search
MADSTKPDSTTSESTRHFDRERAEAAVRELLIAVGEDPDREGLADTPARVARAYEEVFSG
LGTDPTEVLNTTFNEDHRELVLVKDIPFYSTCEHHLVPFFGHAHIGYIPGRSGKVTGLSK
LARLVEGFARRPQVQERLTTSIADALMERLDASAVIVVIEAEHLCMAMRGVRKPGANTVT
SAVRGGFQNNAATRAEAMALIRGN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggctgattcgacaaagcctgattcgaccacgtctgagtcgacgaggcacttcgaccgc
gagcgcgccgaagccgccgtccgcgagctgctcatcgccgtgggggaggaccccgaccgc
gaagggctggccgataccccggcccgtgtggcgcgcgcctacgaggaggtcttctccggc
ctcggcaccgaccccaccgaggtgctcaacaccaccttcaacgaggaccaccgggagctc
gtgctggtcaaggacatcccgttctactccacctgcgagcaccacctcgtgcccttcttc
ggccacgcccacatcggctacatcccggggcgttccgggaaggtcaccgggctgtccaag
ctggcccgcctggtggagggcttcgcccgccgcccgcaggtccaggagcgcctgaccacc
tccatcgccgacgcgctgatggaacggctggacgcctccgcggtgatcgtcgttatcgag
gccgagcacctgtgcatggcgatgcgtggggtgcgcaagccgggcgcgaacaccgtgacc
tccgccgtgcgcggcggcttccagaacaacgccgccacccgcgccgaggccatggcgctg
atccgcgggaactag

DBGET integrated database retrieval system