KEGG   Corynebacterium urealyticum DSM 7111: CU7111_1920Help
Entry
CU7111_1920       CDS       T02457                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cua  Corynebacterium urealyticum DSM 7111
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cua00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CU7111_1920 (rbsK)
Enzymes [BR:cua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CU7111_1920 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2277492..2278532
Genome map
AA seq 346 aa AA seqDB search
MNPGKNPNTAPVDAADTPASVDANSNTAPAVLVCGSINVDTFVGLDEFPHPGETIIGRRG
LQGLGGKGANQAVASARMGVETILLGAVGETSADNPNQPLDPLALLAIKELDEHGVNTVH
IARANQPTGQAFIMNDASGENIIIVTSGANELTSPAELTELAKELADDRPIPVVLAQGEL
TPEHSAELPALAEAIGARLILNLAPVTTKDADLVAASAPIILNELEAADITGLPRETPTE
ELFAALKDVARTCVVTLGPAGAAVIDEAGVTRVPAPQMETIVDTTGAGDAFCGTLAAAVA
TGSSLVDATRVAVAAGSLATQKAGAAASYATEAEIRDLAAEQENRS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccggtaagaacccgaacaccgcgcccgtggacgcggcggacactcctgcatcc
gtcgacgcgaacagcaacactgcacctgccgtcctcgtgtgcggcagcatcaacgtcgac
accttcgtgggcctcgatgagttcccgcaccccggcgagaccatcatcggccgccgcggg
ctgcagggactcggcggcaagggcgcgaaccaggccgtcgcctccgcccgcatgggcgtg
gagacgatcctgctgggtgccgtgggggagaccagcgccgataaccccaaccagccgctc
gatccgctggcgctgctggcgatcaaggagctcgacgagcacggggtgaacaccgtccac
atcgcccgcgccaaccagcccaccggccaggcattcatcatgaacgacgcgtccggcgag
aacatcatcatcgtgacctccggagccaacgagctgaccagcccggccgagctgacagag
ctcgccaaggagctggccgatgaccgccccatcccagtggtgctggcgcaaggtgagctg
accccggagcactccgcggagctgcccgcgttggccgaggccatcggcgcccggttgata
ctgaacctcgccccggtgaccacgaaggacgcggacctggtcgcggcgtccgccccgatc
attctcaacgagctggaggccgcggacatcaccgggctgccccgcgaaacccccaccgag
gagctcttcgccgcgctcaaggacgtcgcccgcacctgcgtggtcaccctgggcccggcg
ggcgcggccgtcattgacgaggcgggcgtgacccgcgtgcccgccccgcagatggagacc
atcgtggacaccaccggtgccggggatgcgttctgcggcacgctcgcggcggctgtggcc
accggttcctccctggtggacgccacccgcgtggctgttgcggccgggtccttggcgacc
cagaaggccggcgcggcggcgtcgtacgcgacggaagcagagatccgcgacctggcggca
gaacaggaaaaccgcagctag

DBGET integrated database retrieval system