KEGG   Corynebacterium ulcerans 809: CULC809_00301Help
Entry
CULC809_00301     CDS       T01880                                 

Gene name
gpmA
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CULC809_00301 (gpmA)
   01230 Biosynthesis of amino acids
    CULC809_00301 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC809_00301 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CULC809_00301 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CULC809_00301 (gpmA)
Enzymes [BR:cuc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CULC809_00301 (gpmA)
Exosome [BR:cuc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CULC809_00301 (gpmA)
  Exosomal proteins of melanoma cells
   CULC809_00301 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
339202..339948
Genome map
AA seq 248 aa AA seqDB search
MTIGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGEMLKQQDVLPTVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKDKYGADQFMEWRRSYG
TPPPELEDSSEFSQANDPRYADLPQVPRTECLKDVVDRFVPYFEEEILPRAQKGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDQDGKVLNPGGTYLDPEAAAAGAA
AVAAQGGK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactatcggaaaactgattcttctccgtcacggacaaagcgagtggaacgcctccaac
caatttactggttgggtggacgttaacctcaccgagcaaggcgaggccgaggccaagcgt
ggcggcgagatgctgaagcaacaggatgtcctgccaactgttgtgtacacatcacttctt
cgtcgagcaatccgcaccgccaacatcgcgcttaacgcagcagatcgccattggatccct
gtcgtgcgcgactggcgtctcaacgagcgtcactatggtgcgctgcagggcctgaacaag
gctgagaccaaggataagtacggcgcagatcagttcatggaatggcgtcgttcctacgga
actcctcctccagagctggaagattccagcgagttctcccaggccaacgatcctcgctat
gccgaccttcctcaggtgccacgcacagaatgcctgaaagacgtcgtggatcgttttgtt
ccttattttgaagaggaaatcctgccgcgggcacagaagggcgagactgttcttattgca
gcgcatggcaattctttgcgtgcattagtcaagcatcttgacaatatctcggatgcagat
attgccgagctcaatattcctactggaattccgctggtatacgagcttgaccaggacgga
aaggttcttaacccgggtggcacctaccttgatccagaggcagcggcagcaggtgctgcg
gcagttgctgcacaaggcggcaaataa

DBGET integrated database retrieval system