KEGG   Corynebacterium ulcerans 809: CULC809_00317Help
Entry
CULC809_00317     CDS       T01880                                 

Gene name
hemD
Definition
uroporphyrin-III C-methyltransferase / uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CULC809_00317 (hemD)
Enzymes [BR:cuc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CULC809_00317 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CULC809_00317 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
352558..354246
Genome map
AA seq 562 aa AA seqDB search
MSLTPQPNPVTPLPEGKVIFVGAGPGNPDLLTVRAREVLSHTAFAVVDAEVLPGVRSVVA
RELDVPADKIQAAEEEYERLCAEAKEAGARRKPQRPDAPTAAEITEVDDEVPVAEIVDKL
KELLTTGEDVIRLVQGNPLSCDRTLEEISAVTQAGLEFHVVPGMSLPATVPAFAGIALGS
SYTETDVTGEDVDWEQLASAPQPLVLQATKDDLPTIAAELKARGLAASTPVTVTAHGTTR
LQRSFDVSLGALSKLDGDLAGTLVVTLGKAVDERTKYSWWENRSLFGWRVLVPRAKEQAG
PMSTLLASQGAIPQEVPTISVEPPRNPAQMEKAIKGIVEGRYQWVIFTSVNAVKAVREKI
GSFGLDARAFAGVRIGAVGTKTAKAIRELGITPELLPPRNQQNAAGLVSVFPEYVEDLDP
VGRVLLPRADIATDVLVEGLEGLGWEVDDVVAYRTVRAAPPSAEVRDMIKSGGFDAVCFT
SASTVKNLVGIAGKPHQRTIIACIGPMAEAAAKELGLRVDVVPEVADVPHLVNSLAAHVA
QLRAAGQLPPPRKKRRARKNRE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcactccgcagcccaatccggttacccctttgccggagggaaaagtgatcttc
gtaggagcaggaccaggaaaccctgatctgctcaccgttcgcgcccgcgaagttctcagc
cataccgcttttgccgtagtagacgcagaagtactcccgggggttcgctctgtagtcgca
cgtgaactggatgttccggccgataagattcaggcggctgaggaagaatacgagcgcctc
tgcgcagaggcgaaagaggccggcgctcgccgtaagccgcagcgtccagatgccccgacc
gcagctgagatcacggaggtggacgatgaggttccggtggcggagattgtcgacaagctt
aaggagcttttgactacgggcgaggacgttatccgccttgtacaggggaaccctttgtct
tgcgaccgtactttggaagaaatatctgcggtcactcaagctggactggaattccatgtt
gttccaggtatgtccttgccagcgaccgttcccgcttttgccggcatcgcactggggtct
tcttatacggaaactgatgtgaccggcgaagacgtggattgggaacagctggcgtcagca
cctcaaccgctggtcttgcaggcaaccaaagatgacctgcccacgatagcggcagagctc
aaggcccgtggattggcggcatcgacaccggtgacggtgactgctcacggcacgacacgt
ttgcagcgaagctttgacgtcagcttgggtgctctgagcaagttggatggggatctcgct
ggcaccctcgtggtcaccttaggcaaagccgtggacgagcgcaccaaatattcctggtgg
gagaatcgctcgctctttggctggcgagtcctggtgcctcgcgctaaagaacaagccggc
cccatgagcacattgttggcttcgcagggggcaattccgcaagaagtccccacaatttcc
gtagaaccgccgcgcaaccccgcgcaaatggagaaagccattaagggaatcgtcgaggga
cgctaccagtgggtgatctttaccagcgttaacgcggtgaaagctgtgcgagaaaagatc
ggttctttcggcctcgatgcccgcgcctttgccggcgtacgcatcggtgcggtgggaaca
aaaaccgctaaggctatccgcgagctggggattactcccgagctgttgccgcctaggaat
cagcaaaatgctgcaggcttagtgtcggtgttcccggaatatgtggaagaccttgaccca
gtgggaagagtcctcttgcctcgcgcagatattgcaacagacgtcctggtagaaggccta
gagggcttgggctgggaagtcgatgatgtggttgcgtatcgcacggtacgcgctgcgccg
ccgagcgcggaagtgcgcgacatgattaaaagtggcggttttgatgcagtgtgctttacc
tctgcgtcgacggtgaaaaacctggtgggcatcgccgggaaaccgcatcagcgcacgatc
atcgcatgcatcggtcctatggcagaagctgcggcaaaagaattaggactgcgagtggat
gtggtccctgaggtggcggatgtcccacacctggtgaacagccttgccgctcacgtggca
caactccgtgcagctggtcagctaccaccgcctaggaagaaacgacgcgcccggaaaaat
cgcgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system