KEGG   Corynebacterium ulcerans 809: CULC809_00318Help
Entry
CULC809_00318     CDS       T01880                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CULC809_00318 (hemB)
Enzymes [BR:cuc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CULC809_00318 (hemB)
Exosome [BR:cuc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CULC809_00318 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
354294..355301
Genome map
AA seq 335 aa AA seqDB search
MSNEDLHLIRRPRRLRNTPVMRELVAETTLRPADLILPMFVADGITEPREISSMPGVYQH
TIPSLIEAVREAISVGIKCVDLFGVPLDADKDAQGSQSWAPEGILNRAITALRQEFGNSV
IIMADTCLDEFTDHGHCGVLSTDRFGEVIVDNDATIPLYQKMAVAQAEAGAHMVSPSGMM
DGQIAAIREALDAHGFQDVAIMAYSAKYASAFYGPFREAVGSSLEGDRRTYQQDPANFRE
SLVEVDLDIEEGADFVMVKPAMPYLDVLAEVAATSVVPVAAYQVSGEYAMLHAAARNNWL
DLERVMMESLISIKRAGADQILTYFAVDAAKKLQH
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaagatctccatctgattcgtcgtccacgcaggctccgaaacacgccggtg
atgcgcgaattagtggcagagacgacgcttcgtcctgctgacctgattcttcctatgttt
gtcgcagacggaataactgagcctcgtgagatttcctctatgcccggtgtctaccagcac
actattccttccttaatcgaggccgtcagggaagccatttccgtgggaattaagtgcgtc
gatctcttcggcgttcctctcgatgcagacaaagatgcgcagggatctcaatcgtgggcg
ccagaggggatcctcaaccgagccatcaccgcgctacgccaggagtttggtaacagcgtc
atcatcatggcagatacctgccttgatgagttcactgatcacggccactgtggcgtgctg
agcaccgatcgctttggcgaggtgatcgtggataatgacgcgaccattccgctttatcaa
aagatggcggtggcgcaggctgaggctggcgcgcacatggtaagtccctccggcatgatg
gatgggcagattgcggcaatccgtgaagctctcgacgctcatgggttccaggacgtggcc
atcatggcgtactccgccaagtatgcgtcggctttctacgggccgtttcgcgaggcagtg
gggtcgtctttggaaggcgaccgcagaacctatcagcaggaccctgctaacttccgggaa
tcgctagtggaagtcgatctggatattgaagagggtgcggactttgttatggtcaaacca
gcaatgccttaccttgacgtgttagcagaggtggccgccacgtcggtcgtaccagttgcc
gcttatcaagtatcaggcgaatacgccatgctgcatgcggccgcccgtaataactggctc
gaccttgaacgtgtgatgatggaatcattgatttctatcaaacgcgctggcgcagaccag
attcttacttactttgccgtcgatgcggcgaaaaaactacagcactag

DBGET integrated database retrieval system