KEGG   Corynebacterium ulcerans 809: CULC809_00322Help
Entry
CULC809_00322     CDS       T01880                                 

Gene name
hemY
Definition
(GenBank) Protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
cuc00860  Porphyrin and chlorophyll metabolism
cuc01100  Metabolic pathways
cuc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CULC809_00322 (hemY)
Enzymes [BR:cuc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CULC809_00322 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CULC809_00322 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Thi4 FAD_binding_2 DAO NAD_binding_9 HI0933_like Pyr_redox Pyr_redox_2 GIDA Mqo
Motif
Other DBs
NCBI-ProteinID: AEG80862
Position
359761..361146
Genome map
AA seq 461 aa AA seqDB search
MRIAIIGAGLAGLTAAYEIHKLDPHVEVEVFEATDRIGGKLFTVPFASGPTDMGAEAYLA
FREDTTEFFKELGLGESLRSPSGLPSLLYAGGSLHGMPSNTIMGIPGTSEGLGDLVSEET
LKRIDEEKDAGSIEWPQEVSLGALLRERLGDDVVDHVVSALQGGVYSSTSDDLSVRATVP
QLARAFDRLKEEGKPVTITGAVQRLLSERETRNKARGYTPSVFASFAGGYAEMYETLAER
SEAKIHIDAFITAIDKTAEGFTLKGAEGVFDKVLLTVPAPTAALLLKNLAPEAAQQLKTI
KLASSAVVGMKFDHSEGLPENSGILVATDAHDVKAKAFTFSSKKWPHLGERGGALVRASF
GRFGDDAIARADEDELVDAALDDLQTITGFDGRAAGLSEIFVQRWFGGLPVYGPGHLETV
AAIKDALAEVQGIDATGAWADGVGVPAVIDAAKAAAKRALA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcattgccattatcggtgcagggttagcgggactaacggctgcttatgagatccat
aaactcgatcctcacgtggaagtagaggtgtttgaggcgacagatcggatcggcggcaaa
ctgtttacagttccgttcgcgtctggccccaccgatatgggcgcagaagcgtacttagct
tttagggaagacactaccgagttctttaaagagctaggactcggtgagagcttgcgctcg
ccctcgggattaccttctttgctatacgcgggaggaagcctccacgggatgccttctaat
acgatcatgggtattcccggcacaagtgagggactgggggacttggtgagcgaggaaacc
ctcaaacgcattgatgaggagaaagatgcgggctcgattgagtggcctcaagaagtaagc
ctgggggcactcctgcgggaacgcttgggtgatgacgttgtggatcacgtggtatcggcg
ctgcaaggtggcgtctattcttccacttcagatgacctaagcgtgcgcgctacggtaccc
cagctagcacgggcctttgaccggctcaaagaagaggggaagcccgtaaccatcacgggt
gctgtccagcgccttctttcggaacgagagacccgcaataaagcgcggggatatactcct
agcgtcttcgcgtctttcgcgggcggctatgcggagatgtatgaaacccttgctgagcgc
agcgaggccaagattcacatcgatgcctttatcaccgcaatcgataagaccgctgaagga
ttcactctcaaaggcgctgaaggtgtctttgacaaggtgctgttgacggtgccagcgccc
actgctgcactgctgctgaaaaaccttgcgccggaggccgcgcagcaacttaaaaccatc
aagttggcaagctctgccgtggtcggaatgaaatttgatcattccgaaggcctccccgag
aattcagggatccttgttgccaccgatgctcacgatgtgaaagcaaaggcctttaccttc
tcctccaagaaatggcctcatcttggcgagcgcggcggcgctttagtccgagcctctttt
ggtcggtttggcgacgacgccatcgcacgcgcagacgaggatgagcttgtcgacgcagcc
ctcgacgatctgcagacgattacgggattcgacggacgcgccgcaggtttatcggagatc
tttgtccaacgctggttcggtggcttgccggtgtatgggccagggcacctggaaacggtg
gctgcaatcaaggacgctcttgctgaggtccagggcatcgacgctaccggcgcatgggcc
gatggcgtcggcgttcctgcagtgatcgacgcagcgaaggctgcggccaaacgcgcgctt
gcctaa

DBGET integrated database retrieval system