KEGG   Corynebacterium ulcerans 809: CULC809_00654Help
Entry
CULC809_00654     CDS       T01880                                 

Definition
(RefSeq) hypothetical protein
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CULC809_00654
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CULC809_00654
   00650 Butanoate metabolism
    CULC809_00654
  Lipid metabolism
   00071 Fatty acid degradation
    CULC809_00654
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CULC809_00654
   00310 Lysine degradation
    CULC809_00654
   00360 Phenylalanine metabolism
    CULC809_00654
   00380 Tryptophan metabolism
    CULC809_00654
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CULC809_00654
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CULC809_00654
   00281 Geraniol degradation
    CULC809_00654
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CULC809_00654
   00627 Aminobenzoate degradation
    CULC809_00654
   00930 Caprolactam degradation
    CULC809_00654
Enzymes [BR:cuc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CULC809_00654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
719236..720069
Genome map
AA seq 277 aa AA seqDB search
MGLLEHAWEGDASRPLGGVETVKVSSDGFVRHIVIDRDERRNALSRDMCLAIAHAVAEAS
AAAVDNASVRAVVISGVGRAFCAGADLGSSVEEQGSDGAVYGSNFHDALFAMLHSIIQAE
VPVIANVQGPAVGAGMQLALACDLRVVGESAWFKIPAVSLGFALDGWTIGRAQKLCGGAF
ARNLLLAGATLTTDAALASGFAVIRGDHAAAVAFAHEMAGLAPLAVRQLKGALNYGETDY
GLDEQSQVLFSRCWSSEDMREARQARSEKRVPQFKGR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgggattgcttgaacatgcttgggagggtgatgcctcgcggcccctgggtggggtagaa
acagtcaaggtatcgtctgatggctttgtgcggcacatagttatagatagggatgagcgg
cggaacgctctttcgcgtgacatgtgcttagccattgcacatgcggttgctgaggcgtct
gctgcggccgtcgataatgcgtcggtgcgtgcggtcgtgattagtggggtgggtcgggcc
ttttgcgcaggtgcagatcttggttcttctgtggaggagcaaggctcggatggcgcagtg
tacggctccaattttcatgatgcgctctttgctatgctgcattcgattattcaggcggag
gtgccggtaatcgccaatgtgcaggggcctgcggtgggggccggaatgcagcttgcattg
gcgtgtgacctccgtgttgttggggaatcggcctggtttaaaattccagccgtgtctttg
ggctttgcgcttgacgggtggacgataggacgtgctcaaaagctctgcggaggtgccttt
gctaggaacctactccttgccggtgccaccttgaccacggatgcagccctggctagtggc
tttgccgtaattcggggtgatcatgctgcagcggttgcttttgcacatgagatggcgggt
ttggcgcctcttgccgtgcgtcagctcaagggggcgcttaactatggtgagactgattat
gggttagatgagcaatcgcaagtgttattttctcggtgctggtccagtgaggatatgagg
gaggcgcggcaagcgcggtcggaaaagcgagtgccgcagtttaaggggcgataa

DBGET integrated database retrieval system