KEGG   Corynebacterium ulcerans 809: CULC809_00654Help
Entry
CULC809_00654     CDS       T01880                                 

Definition
hypothetical protein
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CULC809_00654
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CULC809_00654
   00650 Butanoate metabolism
    CULC809_00654
  Lipid metabolism
   00071 Fatty acid degradation
    CULC809_00654
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CULC809_00654
   00310 Lysine degradation
    CULC809_00654
   00360 Phenylalanine metabolism
    CULC809_00654
   00380 Tryptophan metabolism
    CULC809_00654
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CULC809_00654
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CULC809_00654
   00281 Geraniol degradation
    CULC809_00654
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CULC809_00654
   00627 Aminobenzoate degradation
    CULC809_00654
   00930 Caprolactam degradation
    CULC809_00654
Enzymes [BR:cuc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CULC809_00654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
719236..720069
Genome map
AA seq 277 aa AA seqDB search
MGLLEHAWEGDASRPLGGVETVKVSSDGFVRHIVIDRDERRNALSRDMCLAIAHAVAEAS
AAAVDNASVRAVVISGVGRAFCAGADLGSSVEEQGSDGAVYGSNFHDALFAMLHSIIQAE
VPVIANVQGPAVGAGMQLALACDLRVVGESAWFKIPAVSLGFALDGWTIGRAQKLCGGAF
ARNLLLAGATLTTDAALASGFAVIRGDHAAAVAFAHEMAGLAPLAVRQLKGALNYGETDY
GLDEQSQVLFSRCWSSEDMREARQARSEKRVPQFKGR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgggattgcttgaacatgcttgggagggtgatgcctcgcggcccctgggtggggtagaa
acagtcaaggtatcgtctgatggctttgtgcggcacatagttatagatagggatgagcgg
cggaacgctctttcgcgtgacatgtgcttagccattgcacatgcggttgctgaggcgtct
gctgcggccgtcgataatgcgtcggtgcgtgcggtcgtgattagtggggtgggtcgggcc
ttttgcgcaggtgcagatcttggttcttctgtggaggagcaaggctcggatggcgcagtg
tacggctccaattttcatgatgcgctctttgctatgctgcattcgattattcaggcggag
gtgccggtaatcgccaatgtgcaggggcctgcggtgggggccggaatgcagcttgcattg
gcgtgtgacctccgtgttgttggggaatcggcctggtttaaaattccagccgtgtctttg
ggctttgcgcttgacgggtggacgataggacgtgctcaaaagctctgcggaggtgccttt
gctaggaacctactccttgccggtgccaccttgaccacggatgcagccctggctagtggc
tttgccgtaattcggggtgatcatgctgcagcggttgcttttgcacatgagatggcgggt
ttggcgcctcttgccgtgcgtcagctcaagggggcgcttaactatggtgagactgattat
gggttagatgagcaatcgcaagtgttattttctcggtgctggtccagtgaggatatgagg
gaggcgcggcaagcgcggtcggaaaagcgagtgccgcagtttaaggggcgataa

DBGET integrated database retrieval system