KEGG   Corynebacterium ulcerans 809: CULC809_00654Help
Entry
CULC809_00654     CDS       T01880                                 

Definition
(GenBank) hypothetical protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
cuc00071  Fatty acid degradation
cuc00280  Valine, leucine and isoleucine degradation
cuc00310  Lysine degradation
cuc00360  Phenylalanine metabolism
cuc00380  Tryptophan metabolism
cuc00410  beta-Alanine metabolism
cuc00627  Aminobenzoate degradation
cuc00640  Propanoate metabolism
cuc00650  Butanoate metabolism
cuc00903  Limonene and pinene degradation
cuc01100  Metabolic pathways
cuc01110  Biosynthesis of secondary metabolites
cuc01120  Microbial metabolism in diverse environments
cuc01130  Biosynthesis of antibiotics
cuc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CULC809_00654
   00650 Butanoate metabolism
    CULC809_00654
  Lipid metabolism
   00071 Fatty acid degradation
    CULC809_00654
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CULC809_00654
   00310 Lysine degradation
    CULC809_00654
   00360 Phenylalanine metabolism
    CULC809_00654
   00380 Tryptophan metabolism
    CULC809_00654
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CULC809_00654
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CULC809_00654
   00281 Geraniol degradation
    CULC809_00654
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CULC809_00654
   00627 Aminobenzoate degradation
    CULC809_00654
   00930 Caprolactam degradation
    CULC809_00654
Enzymes [BR:cuc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CULC809_00654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEG81190
Position
719236..720069
Genome map
AA seq 277 aa AA seqDB search
MGLLEHAWEGDASRPLGGVETVKVSSDGFVRHIVIDRDERRNALSRDMCLAIAHAVAEAS
AAAVDNASVRAVVISGVGRAFCAGADLGSSVEEQGSDGAVYGSNFHDALFAMLHSIIQAE
VPVIANVQGPAVGAGMQLALACDLRVVGESAWFKIPAVSLGFALDGWTIGRAQKLCGGAF
ARNLLLAGATLTTDAALASGFAVIRGDHAAAVAFAHEMAGLAPLAVRQLKGALNYGETDY
GLDEQSQVLFSRCWSSEDMREARQARSEKRVPQFKGR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgggattgcttgaacatgcttgggagggtgatgcctcgcggcccctgggtggggtagaa
acagtcaaggtatcgtctgatggctttgtgcggcacatagttatagatagggatgagcgg
cggaacgctctttcgcgtgacatgtgcttagccattgcacatgcggttgctgaggcgtct
gctgcggccgtcgataatgcgtcggtgcgtgcggtcgtgattagtggggtgggtcgggcc
ttttgcgcaggtgcagatcttggttcttctgtggaggagcaaggctcggatggcgcagtg
tacggctccaattttcatgatgcgctctttgctatgctgcattcgattattcaggcggag
gtgccggtaatcgccaatgtgcaggggcctgcggtgggggccggaatgcagcttgcattg
gcgtgtgacctccgtgttgttggggaatcggcctggtttaaaattccagccgtgtctttg
ggctttgcgcttgacgggtggacgataggacgtgctcaaaagctctgcggaggtgccttt
gctaggaacctactccttgccggtgccaccttgaccacggatgcagccctggctagtggc
tttgccgtaattcggggtgatcatgctgcagcggttgcttttgcacatgagatggcgggt
ttggcgcctcttgccgtgcgtcagctcaagggggcgcttaactatggtgagactgattat
gggttagatgagcaatcgcaagtgttattttctcggtgctggtccagtgaggatatgagg
gaggcgcggcaagcgcggtcggaaaagcgagtgccgcagtttaaggggcgataa

DBGET integrated database retrieval system