KEGG   Corynebacterium ulcerans 809: CULC809_00675Help
Entry
CULC809_00675     CDS       T01880                                 

Gene name
folA
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cuc00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cuc00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(741156..741683)
Genome map
AA seq 175 aa AA seqDB search
MLRAIWAQSCDGVIGNGVDMPWHLPEDLAHFKKTTLGCPVIMGRKTWESLPPAFRPLPGR
NNYVLSRSAAGQWSTGACVVNELPDVTDAWVMGGGQIYAATLPKVEEVVRTIVCIELLDV
LGDSAVSAPTLGPEFEVVSETEWMASISGKVHEDYQAATSPQPLHYKFQRLRRTP
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgggcaatttgggcgcagtcctgcgacggggtcatcggcaatggggtggatatg
ccctggcatctgcccgaggatctcgctcattttaaaaaaaccacgcttggctgcccagtc
atcatgggacgcaagacatgggagtcgctgccgccggcctttcgcccgctgcctgggcgc
aacaactacgtactttcccgctccgcagctggtcagtggagcaccggtgcctgcgtggtg
aacgagctacccgacgtcacagacgcgtgggtcatgggaggcgggcaaatttatgcggca
accctacctaaggtggaggaagtagtacgcaccatcgtgtgcattgagcttctcgacgtc
ctcggtgactccgcggtttccgcccctacgcttggccccgagtttgaggttgtatcggaa
actgagtggatggcgtcgataagcggaaaagtacacgaagactaccaagcagcaacttcc
ccacagccgctgcactacaaattccaaaggttgcgacgcactccctga

DBGET integrated database retrieval system