KEGG   Corynebacterium ulcerans 809: CULC809_00711Help
Entry
CULC809_00711     CDS       T01880                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CULC809_00711 (galU)
   00052 Galactose metabolism
    CULC809_00711 (galU)
   00500 Starch and sucrose metabolism
    CULC809_00711 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CULC809_00711 (galU)
Enzymes [BR:cuc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CULC809_00711 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
777536..778597
Genome map
AA seq 353 aa AA seqDB search
MGYMLAQRRREAIRFWQNSENAKKLLYLRWRNWGELSAGCTLVCMKQPQEAQDSTRAAVK
TVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLGATRLAVITAPNKQEVM
EHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPVSVVQEKPLGLGHAVGLAETVLDPEE
DAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCAFEVPEEEVYNYGVFEIDESTYEGPY
HVKKVKGMVEKPSVDEAPSNFVATGRYLLDRAIFDALRRITPGAGGELQLTDAIDLLIDE
GHPVHILVHDGKRHDLGNPGGYIPAVVDFGLSDPVYGPHLKKALRKILEEHGA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggatacatgctagcgcagaggcgtcgagaagctatacgcttttggcaaaacagtgag
aatgcaaagaaacttctttatctcaggtggcggaactggggagaactaagcgccggatgt
actcttgtctgcatgaagcagcctcaagaagctcaagacagtacgcgcgccgcggtaaag
actgtcatcgttcctgctgctggcatgggaacgagattccttccggccacaaaaacagtt
cctaaagagctgttgccagtggtggatactccaggcattgaactgattgcagaagaagca
gctcagttgggtgcgactcgactcgcagtgattacagctcctaataaacaggaagttatg
gagcactttaagcgattcccagtgcttgaagagaccctgcaaagtcgagggaaaacggaa
caatatgagaaagtggtccacgcctctgaacttattgccccggtatctgtagtgcaggaa
aaaccgcttggcctcgggcacgcagtcggtttggcggaaacagttcttgacccggaagaa
gacgccgtagctgtcatgcttcccgatgacctcgtgctcccgcgtggcgttgtggaaaag
atggttgaggtgcgtgaacagctaggcggatctgtgctgtgcgcctttgaagttccagag
gaagaagtctataactacggtgtttttgagattgatgagagcacatacgagggcccttat
cacgtcaaaaaagtcaaaggaatggtggagaagccttctgtagatgaagctccctcaaat
tttgtagcgactggtcgctatctgctggaccgggctattttcgacgccctacgcaggatt
acgccgggcgctggcggtgaattgcagctcacggatgccatcgatttgcttatcgacgaa
ggccatcccgtacacatcctcgtgcacgatggaaagcgacatgaccttggtaatcctggt
ggatatataccggctgtcgttgactttgggctgagcgacccagtgtatggcccccactta
aaaaaggctctccgaaagatcctggaagaacacggcgcctaa

DBGET integrated database retrieval system