KEGG   Corynebacterium ulcerans 809: CULC809_01207Help
Entry
CULC809_01207     CDS       T01880                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CULC809_01207 (tpi)
   01230 Biosynthesis of amino acids
    CULC809_01207 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC809_01207 (tpi)
   00051 Fructose and mannose metabolism
    CULC809_01207 (tpi)
   00562 Inositol phosphate metabolism
    CULC809_01207 (tpi)
Enzymes [BR:cuc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CULC809_01207 (tpi)
Exosome [BR:cuc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CULC809_01207 (tpi)
  Exosomal proteins of bladder cancer cells
   CULC809_01207 (tpi)
  Exosomal proteins of melanoma cells
   CULC809_01207 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1344978..1345757)
Genome map
AA seq 259 aa AA seqDB search
MERTPLIAGNWKMNLDHLKAVATVQKLAFALPKEYYEKVDVAVTVPFTDLRSVQTVVDGD
KLQITYGAQDVSEHESGAYTGEISADMLAKLGCTWVVVGHSERREYHGESSKLVAAKAKA
ALGKGISPIVCVGEPLAIREAGTHVDFVVEQTRESLAGLTEAELAKTVIAYEPVWAIGTG
KVASAADAQEVCKAIRGLVKELANEEIAEGVRILYGGSVKEETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATGL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtacgccgctcatcgctggtaactggaagatgaacttagaccacttgaaagct
gtggcaacagttcagaagctagcctttgcacttcctaaggagtactacgagaaggtcgat
gttgcagttaccgtaccttttacggatctgcggtctgttcagactgtagttgatggcgat
aagcttcagatcacctacggtgcccaagacgtatcagagcatgaatcaggtgcttatacc
ggcgaaatctctgcagatatgcttgcaaagctcggttgcacatgggttgtcgttggacac
tcggagcgtcgtgaataccatggcgagtcctcgaaacttgttgctgcgaaggccaaagca
gcgctgggcaaaggcataagcccgatcgtttgcgtcggtgagcctttggcgatccgggaa
gctggcactcacgtagattttgtcgtcgagcaaacccgtgaatcacttgctggtctgacc
gaagccgaactagctaagaccgttattgcttatgagccggtgtgggcaattggcactggc
aaggtcgcttctgcggctgatgctcaagaagtatgtaaagcgatccgtggtttagttaaa
gaacttgcaaatgaggaaatcgctgaaggcgttcgtattctttacggtggctctgtaaag
gaagaaacggtcgcagaaatagtcggacagcccgacgtagacggtggtcttgttggtggc
gcttctctcgacggtgaggcatttgccaaacttgctgctaacgcagcgactggtctttag

DBGET integrated database retrieval system