KEGG   Corynebacterium ulcerans 809: CULC809_01272Help
Entry
CULC809_01272     CDS       T01880                                 

Gene name
ruvA
Definition
holliday junction resolvasome helicase subunit A (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CULC809_01272 (ruvA)
Enzymes [BR:cuc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CULC809_01272 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1421552..1422166)
Genome map
AA seq 204 aa AA seqDB search
MIVSLRGTVASIGLGSAVIECNGVGYEVLASPSTLAHMSRGEECFVLTTMVVREDSQTLY
GFASDEARQMFTLLQTVSGLGPKLALAAQSVLSATDLAHAIAHQDAKTLQRIPGVGKRVA
ERIIVDLKDKVSAFITAGDAATPAPGGVSLATNDVAAQVLEALLGLGFTEKVAEPVVISV
LADSPNATTSQVLRLALSALGKKK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtttcccttcgcgggactgtagcctccatcggtcttggtagcgcagttattgag
tgcaacggggtcggatatgaagtactcgctagtcccagcaccttggcgcacatgagcagg
ggagaagagtgctttgttctgaccaccatggtggtcagagaagattcccaaaccctttac
gggtttgccagcgatgaagctcggcagatgtttacgctgctgcaaacagtctctggtcta
ggaccaaaactggctctggcagcgcaatcggttttgtccgcaacagatctagcgcatgcg
attgctcaccaggatgcaaagactctccagcgcataccgggagtgggaaaacgagttgca
gagcgcatcatcgttgacctcaaagacaaggtttcagcgtttattaccgctggagatgct
gctactcccgcgccgggaggagtttctttagcaaccaacgatgttgctgcgcaagtactt
gaagctctcctcggcctcggctttacagaaaaagtcgcagaacctgtggtgatttccgtg
ttagctgattctccgaatgcgaccacgtcccaggtgctgcgtctagctctgagtgcgctg
ggcaaaaagaaatag

DBGET integrated database retrieval system