KEGG   Corynebacterium ulcerans 809: CULC809_01439Help
Entry
CULC809_01439     CDS       T01880                                 

Gene name
fpg2
Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cuc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1608514..1609371)
Genome map
AA seq 285 aa AA seqDB search
MPELPEVEVVRRGLECHAVGKTLTSITVSHPRAVRYTEGGAQEIEARLRGRSLSSVHRRG
KFLWFILDDSCALMVHLGMSGQMLIKHANAHSHPHTRIRCSLSDEEARGELWFVDQRTFG
YWRLAELTYAHNRLVPEPMAHIAADLLEPAQDLMATARLIKSKHVEIKKLLLNQEIVAGI
GNIYADEMLWSAQIHPRQKAHRLSLSAIHSLLREGQIVMNKALLQGGTSFDSLYVNVNGE
SGYFDVSLHAYGQEGRPCGRCGCAVMREKFSNRSSHFCPQCQRLQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagttgccagaggtagaggttgttcgtcgaggcctggaatgccacgctgttggg
aagactttgacgtcgataacagtctctcatccgcgtgctgtccgctatacagaaggtggc
gcacaggagattgaggcgcggctacgcgggcggtcgctttcctcggtgcatcggcgtggg
aagtttttgtggttcattttagatgactcctgcgcgctcatggtgcacctgggcatgagt
gggcagatgcttattaagcatgccaacgctcactcgcatccccatacccggattcgttgt
tccctgagcgatgaagaggcacgaggggaattatggtttgtagatcagcgcacgtttggc
tactggcgacttgctgagttgacctatgcccataatcgattagttcccgaaccaatggcc
catatagcggccgatctattggaacccgcgcaagatcttatggcaacagcgcgattgata
aaatccaagcatgtagagattaaaaaactgcttcttaatcaagaaatcgttgcgggaatc
ggcaatatatatgcagatgaaatgctgtggtctgcgcaaatacatcctaggcagaaagca
catcggctttccctgagcgcgattcactcgcttctgcgcgagggacaaatagtgatgaat
aaagccctattgcagggtggaacgagttttgattcgctatacgtcaatgtaaatggggag
tctggctattttgacgtttctttgcatgcgtatgggcaagaaggaagaccttgcgggcgc
tgcggttgtgcggtgatgcgggaaaaattctccaacagatcaagtcacttttgtccacaa
tgtcagcggttgcagtaa

DBGET integrated database retrieval system