KEGG   Corynebacterium ulcerans 809: CULC809_01465Help
Entry
CULC809_01465     CDS       T01880                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
cuc00340  Histidine metabolism
cuc01100  Metabolic pathways
cuc01110  Biosynthesis of secondary metabolites
cuc01230  Biosynthesis of amino acids
Module
cuc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CULC809_01465 (hisD)
Enzymes [BR:cuc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CULC809_01465 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEG81997
Position
complement(1635839..1637158)
Genome map
AA seq 439 aa AA seqDB search
MLSLIDLRGHTPTTSELRRTLPRGGTDVNSVAHIVEPLLHKIHEHGAQAALDFGEKFDHV
RPKSVRVPQDVIDAALDSLTPEVKQALDEAIARVRKVHADQKPQEHATHLAAGATVTEVF
LPVERVGLYVPGGNAVYPSSVVMNVVPAQEAGVTSLVVASPPQAHCGGWPHPTILAAAKL
LGVSEVWAVGGAQAVGLLAYGDDAEGLEPVDMITGPGNIFVTAAKRMVNGVVGIDSEAGP
TEIAIVADGSANPVWIAYDLISQAEHDVLAASVLITDSEDLAERVNAEIKARFEITRNSD
RVAQALQGKQSGIVLVDDLATALTVADAYAAEHLEIHTENAQEDARKIRNAGAIFVGGFS
PVPLGDYAAGSNHVLPTSGSARYSSGLSTHTFLRAVNLIEYDEAALKDISDTIVALADAE
ELPAHGEAIRSRFEDLTAE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtttgatcgatctacgcggacatacccctactacgagtgaactccgtcgtact
ctcccgcgcggaggtaccgatgttaactccgttgcgcatattgttgagccgcttctgcat
aagattcacgagcacggtgctcaagccgcccttgattttggcgaaaaatttgatcacgtg
aggccgaagagcgtgcgcgtcccgcaggacgtgattgacgctgcattggattctttaact
cccgaggtaaagcaggcacttgatgaggctattgcccgagtccgcaaagtccatgctgat
caaaagccacaggaacacgcgacacaccttgctgctggagccacagtcactgaagtattc
ctgcctgtggaacgcgtgggactgtatgttccaggtggaaacgcggtgtatccctcaagc
gttgttatgaacgtggtgccagctcaggaagccggagtcacgtctttggtggtggcatcg
ccaccgcaagctcactgtggtggctggccacacccgacgattcttgcagctgcaaaactg
ctaggagtctcggaagtctgggcggtagggggagcacaagcggtaggacttttagcttac
ggcgatgacgctgaaggtttggagcctgtggatatgatcaccgggcccggaaatatcttt
gttactgcggcaaaacgcatggtcaatggcgtagtaggtattgactcagaagcgggtcca
actgaaatcgcgatcgtagcggatggaagcgctaacccagtatggattgcctatgacctt
attagccaggcagaacatgatgttttagcagcctcagtgttgataacggactcggaagac
ctcgcagaacgcgttaatgctgagataaaggcgcgctttgagattacgcgcaactcagat
cgggttgcccaagctctccaagggaagcaatcgggcatcgtgcttgtcgacgatctcgcg
accgcgctgactgtcgccgatgcttatgctgcggaacacttggagatccacacggaaaat
gcccaggaggatgctcgcaagatacgcaacgcaggcgctatctttgtcgggggtttctcg
ccggttccgcttggcgattatgccgcaggctctaaccatgttcttccgacgtctgggagt
gcgcgttatagctcggggctttccacacatactttcctccgcgcggtgaacctcattgaa
tatgatgaggccgcgctaaaagacatctcggatacgattgttgctcttgccgacgcagag
gagcttcctgcgcacggagaggctattcgttccaggtttgaggacctcaccgcagagtga

DBGET integrated database retrieval system