KEGG   Corynebacterium ulcerans 809: CULC809_01519Help
Entry
CULC809_01519     CDS       T01880                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
cuc00010  Glycolysis / Gluconeogenesis
cuc00052  Galactose metabolism
cuc00500  Starch and sucrose metabolism
cuc00520  Amino sugar and nucleotide sugar metabolism
cuc00521  Streptomycin biosynthesis
cuc01100  Metabolic pathways
cuc01110  Biosynthesis of secondary metabolites
cuc01120  Microbial metabolism in diverse environments
cuc01130  Biosynthesis of antibiotics
cuc01200  Carbon metabolism
Module
cuc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC809_01519 (glk)
   00052 Galactose metabolism
    CULC809_01519 (glk)
   00500 Starch and sucrose metabolism
    CULC809_01519 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CULC809_01519 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CULC809_01519 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CULC809_01519 (glk)
Enzymes [BR:cuc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CULC809_01519 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Hydant_A_N TCR FGGY_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: AEG82051
Position
complement(1698504..1699457)
Genome map
AA seq 317 aa AA seqDB search
MSERSDAVTVGFDIGGTNMRAAAVTSDGQIIDSMSVPTPSTPELLESGIIELVDALRQKH
EISAVGLAVAGFLDPDCEVVRFAPHLPWRDRAVRAELSESLGLPVRLEHDANSAAWGEYR
FGAAQGADNWVLFAVGTGIGATLMHQGEIYRGAFGTAPEFGHLTVVPGGRVCSCGKRGCL
ERYCSGTALETTAREMIAAGKATDSVLIDALANGSLSGKRIMAAAGDGDQLACAVVEDFA
QWMGRALSIVADVLDPGLIVIGGGVSTASALYLDTAVETMSTSMVGAGYRPLPKVSCAEL
GGDAGMIGVSDLARQLV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagatccgacgcagtcaccgtgggctttgatattggtggaactaacatgcgg
gcggcggcggtgacttcggatgggcagattattgactctatgtcggttcctacgccatcg
actcctgaattgctcgaatccggaatcatcgagctggtagacgctctgaggcagaagcat
gagatttccgcagtagggttggcggtagctggttttttggatcctgattgtgaagttgtt
cgttttgctccgcatctcccgtggagagatcgagctgttcgcgcagagctttcagaatcc
ctaggattaccggttcgtctcgagcacgatgcaaattcggcagcatggggagaatatcgg
tttggtgccgctcagggggcagataactgggttctctttgcggtaggtaccggaattggt
gcaactctcatgcatcaaggagagatttatcgtggagcgtttggcacagcgccagaattt
ggtcatctcactgtagtcccagggggacgggtatgctcctgcggcaaacgtggatgtcta
gagcggtattgttcaggaacggctttggaaactactgcccgtgagatgattgcagcgggt
aaagcaaccgattccgtgcttatcgacgctctagctaacggttccttaagcggtaaacgc
attatggctgcagctggtgatggtgatcagcttgcttgcgccgttgtagaagatttcgcc
caatggatgggacgagctctgtccatagtggcagatgtccttgatcccggacttatcgtg
atcggtgggggagtatccactgcaagcgcactctacctcgatactgctgtggagacgatg
agtacatcgatggtgggggcagggtaccgcccccttcccaaagtttcgtgtgcggagcta
ggtggagatgcgggtatgatcggggtatctgatttggctcgccaattggtctga

DBGET integrated database retrieval system