KEGG   Corynebacterium ulcerans 809: CULC809_01538Help
Entry
CULC809_01538     CDS       T01880                                 

Gene name
sucB
Definition
dihydrolipoamide acyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cuc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cuc00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cuc00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1720182..1721855
Genome map
AA seq 557 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVAVDEPLLEVSTDKVDTEVPSPVAGVLLEVR
FDEDDTVDVGEVIAIIGEEGEAPAASDSAEKKEEPKAEAQAEEETTTESKEAPKGSGSST
DVVMPELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNE
DDTVDVGEVIVRIGEPGSEPETKAEPAKEEPKEEAPKAEEPAKEAPKAEEAPAKEAAKPV
NNQNVPYVTPLVRKLANKHGVDLNKIEGTGVGGRIRKQDVLAAAGQGSEPVAAAAPAAAA
KDPRANWSTKSVDPAKAELIGTTKKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVAT
LRKENKPAFIEKYGANLTYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNVAIAV
DTERGLLTPVIHKAQELTLPEIAQAIADLADRARNNKLKPNDLSGATFTVTNIGSEGALA
DTPILVPPQVGILGTAAIQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTA
TIKDRLEKAKFQDDLNL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgagctgggcgaatccgtcactgagggaacaattact
cagtggctcaagtctgtcggcgacaccgtcgcagtcgacgagccgttgctcgaggtttcc
actgacaaggttgacaccgaggttccttccccagttgcgggcgttctgttggaggttcgc
ttcgacgaagacgacaccgttgatgtcggcgaggttatcgccatcatcggtgaggaaggc
gaggctcctgcagcaagcgattccgctgagaagaaggaagagccgaaggcagaggcacaa
gccgaagaagaaaccacaactgaatccaaggaagctcccaagggctccggatcctccacc
gacgtggtcatgccagaactcggcgaatccgtcaccgaaggaacaatcacccagtggctc
aagtctgtcggcgacaccgtcgacgttgacgagccattgctcgaggtttccaccgacaag
gttgacaccgaggtcccttccccagtggcaggcaccatcctagaaatcctcttcaacgaa
gacgacaccgttgatgtcggcgaagttatcgtccgcatcggcgaaccaggctccgaacca
gaaaccaaggcagaacctgccaaggaagagccaaaggaagaagctcccaaggcagaagaa
ccagccaaggaagctcccaaggctgaggaagcacctgctaaggaagctgcaaagccagtt
aataaccagaatgttccttacgtgaccccattggttcgtaagcttgccaacaagcatggc
gttgatctcaataagatcgaaggaactggtgttggcggtcgcatccgtaagcaggacgtc
cttgccgcagctggtcaaggatctgagccagttgcggcagcagctcctgctgccgcggct
aaggatcctcgcgctaactggtcaaccaagagcgttgaccctgcaaaggcggagctcatc
ggcaccaccaagaaggtcaaccgcatccgcgagattacggccaagaagatggttgaggca
ctgcagatttctgcacagctcacgcaccttcaagaggtcgatatgaccaacgttgcaacg
ctgcgcaaggaaaataagccggcattcatcgaaaagtatggcgctaacctgacctatctg
ccgttctttgttaaggccgtggtcgaggctctggtcctacacccgaacgtaaacgcgtct
tacaacgctgcaaccaaggaaatcacctaccactctgacgtcaatgtggcgatcgcagtg
gacaccgagcgtggcctgcttactcctgtgattcacaaggctcaggagcttacgctgcca
gaaatcgcccaggctattgctgatctggctgatcgtgctcgtaacaacaagctgaagcca
aatgatctctccggcgcaaccttcaccgtaaccaacattggctccgaaggtgctctggca
gatacaccaatcttggttccgccacaggtcggtatcttgggtactgctgcaatccagaag
cgccccgtagtgatcactgaaaacggttcggacgccatcgcgattcgccagatgtgctac
atcccgttctcctatgaccaccagatcgtagacggtgctgacgcaggtcgcttcaccgca
acgattaaggatcgtttggaaaaggctaagttccaggacgacctcaacctctag

DBGET integrated database retrieval system