KEGG   Corynebacterium ulcerans 809: CULC809_01538Help
Entry
CULC809_01538     CDS       T01880                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide acyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CULC809_01538 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CULC809_01538 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CULC809_01538 (sucB)
Enzymes [BR:cuc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CULC809_01538 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1720182..1721855
Genome map
AA seq 557 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVAVDEPLLEVSTDKVDTEVPSPVAGVLLEVR
FDEDDTVDVGEVIAIIGEEGEAPAASDSAEKKEEPKAEAQAEEETTTESKEAPKGSGSST
DVVMPELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNE
DDTVDVGEVIVRIGEPGSEPETKAEPAKEEPKEEAPKAEEPAKEAPKAEEAPAKEAAKPV
NNQNVPYVTPLVRKLANKHGVDLNKIEGTGVGGRIRKQDVLAAAGQGSEPVAAAAPAAAA
KDPRANWSTKSVDPAKAELIGTTKKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVAT
LRKENKPAFIEKYGANLTYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNVAIAV
DTERGLLTPVIHKAQELTLPEIAQAIADLADRARNNKLKPNDLSGATFTVTNIGSEGALA
DTPILVPPQVGILGTAAIQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTA
TIKDRLEKAKFQDDLNL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgagctgggcgaatccgtcactgagggaacaattact
cagtggctcaagtctgtcggcgacaccgtcgcagtcgacgagccgttgctcgaggtttcc
actgacaaggttgacaccgaggttccttccccagttgcgggcgttctgttggaggttcgc
ttcgacgaagacgacaccgttgatgtcggcgaggttatcgccatcatcggtgaggaaggc
gaggctcctgcagcaagcgattccgctgagaagaaggaagagccgaaggcagaggcacaa
gccgaagaagaaaccacaactgaatccaaggaagctcccaagggctccggatcctccacc
gacgtggtcatgccagaactcggcgaatccgtcaccgaaggaacaatcacccagtggctc
aagtctgtcggcgacaccgtcgacgttgacgagccattgctcgaggtttccaccgacaag
gttgacaccgaggtcccttccccagtggcaggcaccatcctagaaatcctcttcaacgaa
gacgacaccgttgatgtcggcgaagttatcgtccgcatcggcgaaccaggctccgaacca
gaaaccaaggcagaacctgccaaggaagagccaaaggaagaagctcccaaggcagaagaa
ccagccaaggaagctcccaaggctgaggaagcacctgctaaggaagctgcaaagccagtt
aataaccagaatgttccttacgtgaccccattggttcgtaagcttgccaacaagcatggc
gttgatctcaataagatcgaaggaactggtgttggcggtcgcatccgtaagcaggacgtc
cttgccgcagctggtcaaggatctgagccagttgcggcagcagctcctgctgccgcggct
aaggatcctcgcgctaactggtcaaccaagagcgttgaccctgcaaaggcggagctcatc
ggcaccaccaagaaggtcaaccgcatccgcgagattacggccaagaagatggttgaggca
ctgcagatttctgcacagctcacgcaccttcaagaggtcgatatgaccaacgttgcaacg
ctgcgcaaggaaaataagccggcattcatcgaaaagtatggcgctaacctgacctatctg
ccgttctttgttaaggccgtggtcgaggctctggtcctacacccgaacgtaaacgcgtct
tacaacgctgcaaccaaggaaatcacctaccactctgacgtcaatgtggcgatcgcagtg
gacaccgagcgtggcctgcttactcctgtgattcacaaggctcaggagcttacgctgcca
gaaatcgcccaggctattgctgatctggctgatcgtgctcgtaacaacaagctgaagcca
aatgatctctccggcgcaaccttcaccgtaaccaacattggctccgaaggtgctctggca
gatacaccaatcttggttccgccacaggtcggtatcttgggtactgctgcaatccagaag
cgccccgtagtgatcactgaaaacggttcggacgccatcgcgattcgccagatgtgctac
atcccgttctcctatgaccaccagatcgtagacggtgctgacgcaggtcgcttcaccgca
acgattaaggatcgtttggaaaaggctaagttccaggacgacctcaacctctag

DBGET integrated database retrieval system