KEGG   Corynebacterium ulcerans 809: CULC809_01561Help
Entry
CULC809_01561     CDS       T01880                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
cuc00260  Glycine, serine and threonine metabolism
cuc00750  Vitamin B6 metabolism
cuc01100  Metabolic pathways
cuc01110  Biosynthesis of secondary metabolites
cuc01120  Microbial metabolism in diverse environments
cuc01230  Biosynthesis of amino acids
Module
cuc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CULC809_01561 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CULC809_01561 (thrC)
Enzymes [BR:cuc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CULC809_01561 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP PLCC
Motif
Other DBs
NCBI-ProteinID: AEG82093
Position
complement(1746378..1747946)
Genome map
AA seq 522 aa AA seqDB search
MPGSVASSYDIKIDAIGGGSDKKCPSVFFSARAVDASVVAVHYISTRDTSQTPVAFTDIL
LGGLAPDGGLYLPEYYPRLDAATLDTWRGILAQQGYAALAAEVLKLFVDDIPAADLEAIT
ARAYTTPKFADEEIVPVTKLEDGIYIGHLSEGPTAAFKDMAMQLLGELFEYELRRRKETL
NILGATSGDTGSSAEYAMRGRAGIRVFMLTPKDRMTPFQQAQMFGLDDPNIFNIALDGVF
DDCQDVVKAVSSDADFKANNHIGAVNSINWARLMAQVVYYISSWLKVTENNDQKVSFCVP
TGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFKTGEYRVRSAAETHETSSPSMDI
SRASNFERFIFDLLGRDAERCSELFGEQVKAGGFSLADDESFEHAATHYGFASGSSTHAD
RIATIADCYTRRGLMLDPHTADGVKVAREWASQIESPIVCLETALPVKFTDTIVEAVGRG
PEIPERFTGILDAPRHVTDLPNDVAAVKDFILESIARDTAGA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcctggttcagtcgcgagctcatacgatataaaaatcgatgcaattggtgggggtagc
gataagaaatgtccatccgttttcttcagcgctagagccgtcgacgctagtgtagtagcc
gtgcactacatttcgacaagagacacttcccagacccccgtagcgtttactgacatactt
ttgggtggtcttgccccagacggcggtttgtaccttcctgagtattatccgcgtctcgac
gctgccacgttagatacctggcgcggtattctcgcccagcaaggttacgcagcactagcc
gcagaagtgcttaagctctttgtcgacgacatcccggcagcggatctagaagccattact
gcgcgcgcttacacgacgcccaagtttgccgacgaagaaatcgtcccggtgaccaagctc
gaggacggcatttatataggccacctatctgagggaccgaccgccgcattcaaagacatg
gccatgcagcttcttggcgagctctttgaatatgagctacgccggaggaaagagacctta
aacattctgggtgccacctctggcgacacaggatcctctgctgaatacgcgatgcgtggg
cgtgcaggaatccgtgtgttcatgctcacccctaaagaccgcatgacgccattccagcag
gcccagatgtttggtctggatgacccaaatatctttaatatcgcgctagatggcgttttt
gatgattgtcaagacgtggtcaaagctgtgtcgtccgacgcggattttaaagcgaacaac
cacattggtgcagtgaactcaattaactgggcccgtttgatggcgcaagtggtctactac
atttcttcgtggctcaaagtaacggagaacaacgatcaaaaagttagtttctgcgttccc
accggaaactttggcgatatctgtgccggacacattgctaagcaaatggggctgccgatc
gacaggctcatcgttgccaccaatgaaaacgatgttcttgatgagttctttaaaaccggt
gagtaccgtgtgcgctctgcagctgagactcatgagacatcctcgccctcgatggatatt
tctagagcgtccaactttgagcggtttatttttgacctgttaggaagagatgccgagcgc
tgctcagaactctttggggaacaagtaaaagctggcggtttttctcttgccgatgacgaa
tcatttgagcacgctgccacgcattatggttttgcgtcgggtagttccacccacgcagac
cgtatagccaccatcgccgattgctatacgcgccggggcctgatgttggatccgcatacc
gctgatggcgtgaaagtcgcgcgcgagtgggctagccagattgaaagccccatcgtgtgt
ttggagaccgctctacccgtgaaattcacggataccattgtagaagcagtaggacgcggt
cctgagattccagagcgctttactggaatcttggatgcaccacgccatgtcacagatcta
cctaatgatgtggctgcagtgaaggacttcattctagagagtattgctcgagatactgcg
ggtgcttaa

DBGET integrated database retrieval system