KEGG   Corynebacterium ulcerans 809: CULC809_01714Help
Entry
CULC809_01714     CDS       T01880                                 

Gene name
pncA
Definition
pyrazinamidase / nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cuc00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1927010..1927564
Genome map
AA seq 184 aa AA seqDB search
MRALIIVDVQNDFCPGGALETVKGAIQAQSIAEYTALHGKKYGCIAATKDWHIDPGDHFS
ETPDFIDTWPVHCMAHTEGADFHPLLLNTHFDEVFYKGHYSAAYSGFEGSTADGQLLSTW
LKDRGVREIDIAGIATDYCVQATALDGLREGFQVTVLSSLCAAVNEDNTRAVLRRLTDHG
CVLG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccctcatcattgttgacgtccaaaatgatttttgtccgggcggggcgttagaa
acggtcaagggtgcaattcaagcacaatctattgcagaatacacagcacttcacggaaaa
aaatacggctgcattgcagccaccaaagactggcatatagaccctggcgatcacttttct
gaaaccccagattttattgatacgtggcccgtacattgtatggctcatacagagggcgcc
gattttcatccgttgctcttaaatacccactttgatgaggtgttctataaagggcactac
agcgccgcctactcagggttcgagggttccacggcagatgggcaactcttaagcacatgg
ctaaaagaccgtggggtacgcgagattgatatcgcggggatcgctacggattactgtgtt
caggctacggctctcgacggtctacgagaaggcttccaggtaacggtgctctcgagcctg
tgcgccgcagtcaatgaggacaacacccgcgcagttttgcgtaggctcacagaccacggg
tgtgtcctcggttaa

DBGET integrated database retrieval system