KEGG   Corynebacterium ulcerans 809: CULC809_01862Help
Entry
CULC809_01862     CDS       T01880                                 

Gene name
folP2
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cuc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2099995..2100777)
Genome map
AA seq 260 aa AA seqDB search
MTHVMGIVNVTTDSFSDGGKYLDLDSAVAHAKQLVAEGADIIDVGGESTRPGATRVSEQV
ELARVVPVIKALHAEGIRTSVDTMRASVAAAAAEAGVSMLNDVSGGLADKNMYSVMADTQ
LPACLMHWKTGTFGDAAGAHHTDVVREVHEGLDILVDNALAAGIDAKAIVIDPGLGFAKT
AEDNWALLNALPEFMREYPVLVGASRKRFLASLGSDVDAATAAVTAIVAHQGVWCVRVHN
VALSRAAVDVAAKWRKHGSH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacgtaatgggaattgtcaacgtgactactgattccttttctgatggcggaaag
tatctcgatctcgactccgcggtggcgcatgccaagcaactcgtggcagagggcgcggac
atcatcgacgtaggcggcgagtccacccgcccaggtgccactcgcgtgagcgaacaggtt
gagcttgcccgcgtcgttcctgtgattaaagccctgcatgctgaaggaatcaggacgtca
gtagataccatgcgtgcctcggtcgccgccgcagcagccgaggccggggttagcatgctt
aacgacgtctccggcggcctcgcagataagaacatgtactcggttatggctgatacacag
cttcccgcgtgcttgatgcactggaaaacagggacctttggggatgccgcaggcgcgcat
cataccgacgtggtgcgtgaagttcatgagggcctggacatactcgttgataacgccctt
gccgctggcattgacgcgaaagccattgtcatcgacccaggcctcgggtttgctaaaact
gcagaggacaactgggctttattgaacgctcttccagaatttatgagagagtatccggta
ctcgtgggggcgtcgagaaagcgctttttagctagcctaggctcagacgtggacgcggcg
actgccgcagtcacagcaatcgtggcgcatcaaggcgtgtggtgcgtccgggtgcacaac
gtggcgctatcccgtgccgctgtggatgttgcggcgaaatggaggaagcatggatcgcat
tga

DBGET integrated database retrieval system