KEGG   Corynebacterium ulcerans 809: CULC809_01971Help
Entry
CULC809_01971     CDS       T01880                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CULC809_01971 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC809_01971 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CULC809_01971 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CULC809_01971 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CULC809_01971 (adhA)
   00626 Naphthalene degradation
    CULC809_01971 (adhA)
Enzymes [BR:cuc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CULC809_01971 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2219302..2220339)
Genome map
AA seq 345 aa AA seqDB search
MKNDFPEAFTAAVVDDFGPELTIHDVDLPEPGPNQALVKLVASGICHTDLHAAEGDWPVK
PEPPFVPGHEGVGEVVKLGPGHHGVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYG
GYTVDGSFGEYMLVDTRYCARIPEGSDPIEVAPILCAGVTVYKGLKETECKPGQYMVISG
IGGLGHIAVQYAVAMGMRVIAVDIADEKLELARKHGAEFAVNALKEDPVEAINAFTKGGA
HGVLVTAVHPQAFGQAIGMTRKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQD
LEEALDFYARGMIKPTVTECKLDDVNSVFADMHQGKVDGRMAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacgatttccctgaggccttcaccgctgctgtagttgacgactttggccctgaa
ctcactattcatgatgtagatttgcctgagccgggacccaaccaggcgctggtgaaacta
gtagcttccggcatttgccatacagaccttcacgcagcggaaggcgactggccagtgaaa
ccggaaccaccgtttgttcctgggcatgaaggcgtgggcgaagtcgttaaattagggcct
ggccatcacggagtgcagctcggagatatggtgggcaacgtatggctatggtctgcgtgt
ggggagtgcgagtattgccgcaccggccgcgaaactctttgcaatgacgcggaatatggt
ggctacacggttgatggctccttcggtgaatacatgctggtagatacccgttactgtgct
cgcattccagagggatctgaccccatcgaggttgccccgatcttgtgtgctggtgtgact
gtatataagggcctcaaagaaactgagtgcaagccgggccagtacatggtcatttctggt
atcggcggtctgggccatatcgctgtgcaatatgcggtagctatgggtatgcgcgtaatt
gcagtggatatcgcggacgaaaaattagagcttgcgcggaaacatggtgctgaatttgca
gtaaatgcgttgaaggaagacccggttgaagcgatcaatgcttttactaagggtggtgcg
catggcgttctggtcaccgctgttcacccgcaagcgttcggtcaagccattggtatgact
cgaaaaggtggaacgatcgtatttaatggtcttcctccaggagagttccctgcacctatc
tttgagattgtgttcaaggggctaaccattcgcggatcgctggtgggaacacgccaggat
ttggaagaagctctcgatttctatgcgcgcggcatgattaagcctactgttacggaatgc
aagcttgacgacgtcaacagtgtcttcgccgatatgcatcagggcaaagtcgatgggcgc
atggcgattaggtactaa

DBGET integrated database retrieval system