KEGG   Corynebacterium ulcerans 809: CULC809_02018Help
Entry
CULC809_02018     CDS       T01880                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CULC809_02018
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CULC809_02018
Enzymes [BR:cuc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CULC809_02018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2280963..2282159)
Genome map
AA seq 398 aa AA seqDB search
MRRLRESDSKAIHITIPWFTGWAMHIKRLLAAALLGALAACSDAGTDTDPAITEATTAST
TASATQETSAPPSIKAQPHDVRAQAASLMMVGVSNYDDALSALNQGVGGIFIGSGTDPNL
LTAPGRNIEALRKAVGRDFSVSIDFEGGRVLRHQGILGTFPSPQVMAQTMTPEQVRGMAK
TMGDSLFAHGVTVNFAPVADIDAGLDVVGDRAFSADPTIDAEYAAAFAQGMLDAGVRPVF
KHFPGHGRASGDSHTGQVFTPPLGDLENIDLVPYSRINVPGAGVMLGHMVVPDLGSPKNG
LPSTLNPAAYQLLRTGSYRGGHPFDGVVYTDDLAMGAVTGIMPVPQAVVASLQAGADQAL
WVTTAGLKEAIDATVAAVETGAYPRAQFEDSVRRVGVL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcggttaagggaatcggattcaaaagccatacatataacaataccgtggtttact
ggatgggcaatgcacataaaacgacttctcgccgccgccctcctcggtgcgctcgccgca
tgcagtgacgccggaaccgatacggatcccgccatcaccgaggccactactgcgtccacc
actgcgtccgcaacgcaggaaactagtgcgcccccaagcataaaggcacagcctcacgac
gtccgcgctcaagccgcgagcctcatgatggtgggagtaagtaattacgacgacgccctc
tctgccttaaaccaaggtgttggaggcatcttcatagggtcaggtacagatcccaacctc
ctcaccgcgccgggtagaaacatcgaggcattgcgtaaggccgtggggcgcgatttctct
gtctccatcgactttgaaggcgggcgggttctccgacaccaaggaatcttagggaccttc
ccctcaccccaagtgatggcgcaaaccatgacccctgagcaggttcgaggcatggctaaa
acgatgggcgactcactgttcgcacacggggtaacggtgaactttgcgccagttgcggac
atagacgctggactagacgtcgtgggcgatcgcgcttttagtgcggaccccactattgat
gctgaatatgcggcagcctttgctcaaggaatgctagacgcaggagttcggccagtgttt
aagcatttccccggacacggacgcgctagtggtgactcccacacagggcaggtatttacc
ccgccattgggagacctagagaacattgacttggtgccctatagccggattaatgtcccc
ggtgctggcgtgatgctcgggcacatggtggttcccgatctaggctcgcccaagaatggt
cttccctccacccttaatccagccgcctaccagctgctgcgtactggttcttatcgcggc
ggacatcctttcgatggtgtggtctataccgacgatcttgccatgggcgcagttacggga
attatgcctgttccccaagctgtggtggcgtcgttgcaagcaggtgccgatcaagcattg
tgggtgaccactgctggcctcaaagaggctatcgacgccaccgttgcggctgtggaaacg
ggcgcatatcccagagcccaatttgaagactctgtgcgcagggttggcgttctttga

DBGET integrated database retrieval system