KEGG   Corynebacterium ulcerans 809: CULC809_02072Help
Entry
CULC809_02072     CDS       T01880                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CULC809_02072 (deoA)
Enzymes [BR:cuc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CULC809_02072 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2352759..2354045
Genome map
AA seq 428 aa AA seqDB search
MAEKFDAVDVIRTKRDKGKLSKGQIDWIIDAYTRGVVGDDQMAALNMAIFLNGMDREEIV
QWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAPLVASYGVAVPQLSGRGLGH
TGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGLAPADKKIYALRDITATVDC
IPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQARELARTMVDLGRDAGTNMVALL
TDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALATEMLELAGVHDPDVHEALAD
GRAMDSWKKMIRAQGGDPDAALPTARHTHEITADHDGYLTEMDALALGVASWRLGAGRAR
KEDPVQLGAGIEIHAGLGEKVTKGQKLFTLHTDDEDRFDRALESLEPGVKIGDEAPAPRT
SVILDRIS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagaagttcgacgccgtagacgtcatccgcacaaagcgggataaaggaaagctg
agcaaggggcaaatcgactggatcatcgatgcctacactcgcggtgtcgtcggcgacgac
caaatggccgccctcaacatggcaatattcctcaatggcatggatcgagaagaaatcgtc
cagtggacccaggccatgatcgactccggcgaaaccatgagctttgccagcctctcccgc
cccaccacagacaagcactccaccggcggcgttggtgataaaatcaccctccctctcgca
ccgctcgttgccagctatggcgttgccgtgccacagctctccggaagaggactaggacac
accggcggaaccctggacaaactagaagccatccccggctgggaagccgacatagataac
gcccgcatgatgaagatcctggaagacccaggctgcgtagtatgcgccgcgggagccgga
ctggcaccagcagacaagaagatctatgcgctgcgcgacatcaccgctaccgtcgactgc
atccctttgatcgccagctccatcatgagtaaaaagatcgccgaaggaaccgcgaacctt
gtcctcgacgtcaaggtcggctctggcgcctttatgaaggagcttgatcaggcacgcgag
cttgcccgcaccatggttgaccttggccgcgacgccggaaccaacatggtcgcactcctc
acagacatgtccgtacctctaggtcgcaccatcggcaacgccctggaagttcgcgagtcc
gtagaagtactcgcaggtggcggaccttccgacgtcatagagctcacctgcgcccttgca
acagaaatgcttgaactcgccggcgtccacgatcctgacgtgcatgaagcgcttgccgac
ggccgcgcaatggattcctggaagaagatgatccgtgcacagggcggcgaccccgacgct
gcactccccaccgcacgccacacccacgagatcaccgccgaccacgacggctacctcaca
gaaatggatgccctcgcactaggcgtagccagctggcgacttggcgcaggacgtgcccgc
aaggaagacccagtccagcttggcgctggcatcgagattcatgcaggactcggcgagaag
gtaacaaaaggccagaagctcttcacactccacaccgacgatgaagaccgttttgaccgc
gccctagagtctctcgaacccggcgtaaagattggcgacgaggccccggccccacgcact
tcggtcatcctcgaccgcatcagctag

  All links  
No link information was found.   
DBGET integrated database retrieval system