KEGG   Corynebacterium ulcerans 809: CULC809_02173Help
Entry
CULC809_02173     CDS       T01880                                 

Gene name
trpC1
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
cuc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cuc01100  Metabolic pathways
cuc01110  Biosynthesis of secondary metabolites
cuc01130  Biosynthesis of antibiotics
cuc01230  Biosynthesis of amino acids
Module
cuc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CULC809_02173 (trpC1)
Enzymes [BR:cuc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CULC809_02173 (trpC1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CULC809_02173 (trpC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AEG82697
Position
2474099..2475589
Genome map
AA seq 496 aa AA seqDB search
MHNNATSMPTVLEEIVHTRRSHLQEIRARIAHVDPLRLPRSTKSLFQALGGSASGGVAPR
RQAHSDTSTRAPHFIMECKSASPSLGDIRADYSPGDIARIYSRYASAISVLCEPDKFNGD
YDHLATVAASTHLPVLCKDFIINPVQVHAARYFGADAILLMLSVLDDATYISLSHEAERL
GLDVLTEVINEEEVKRAIRLGAKIFGVNHRNLHDLSIDLSRSSQLETLVPDTAILVSESG
IQTNETVRQLAGHSDAFLVGSQLTGCIDVDSAARSLVFGTNKVCGLTTASGAQTARAVGA
THGGLIFEDSSPRNVSRETAQKIIAAEPHLHYVAVSRRTQDWAEMLLPGIKTLQIHTPYQ
GSIAGERELLNKARAELLKAGREDIAIWRAVSMTAPEGPDIAVALMDDVDMILLDAGAGG
TGTPFPWEKIPRGVTPKAILAGGLNPDNLPEALVRGCAGLDLNSGVEYPANAGIWAGLKD
SGALRQAFSTIREFHY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcacaataatgcaacgtccatgcccacagtcttagaagaaattgttcacacccgccga
tcacatcttcaagagattcgtgcccgcattgcacatgtagatcctctccggttgccgcgg
tccacaaaatctctttttcaggcactcggaggttccgcgagtgggggagtggcgccgcgt
cgtcaagcacattctgacacctctacacgggcgccgcacttcattatggagtgcaaatcc
gcatcaccgtcattaggggacatccgagctgattattccccaggagacattgcacggatt
tactctcgctacgcttccgcgatttccgttctttgcgagcccgacaaatttaacggcgat
tacgatcacctggccaccgttgcagcttccacgcatctgccggttctatgcaaggacttc
atcatcaatcccgtgcaggtgcacgctgcacgctactttggcgcggatgcgatcctactc
atgctgagcgtgcttgacgacgccacctacatctcactttcccatgaagccgaacgcctc
ggcctagacgtcctcaccgaagtaatcaacgaggaggaggtaaagagagctattcgcctt
ggcgcaaagatttttggtgtcaatcaccgcaacctacacgacctcagtatcgacctttcc
cgttcctcacaactagaaaccctcgttccggacaccgctatactcgtgtcagaatccggc
atccaaacaaacgagactgtccgccagttggcaggccattccgacgccttccttgtcggc
tcacaactcaccggctgcatcgacgttgactccgccgcacgttcactcgttttcgggacc
aacaaggtgtgtggactcaccaccgcttccggcgcccaaactgcgcgcgcagtcggcgca
acgcatgggggattgatatttgaagactccagccctcgcaatgtttcacgtgaaactgcc
caaaaaatcattgcggcagagccacatctacactacgttgcggtgagtagacgcactcaa
gactgggcggaaatgctccttccgggtattaaaaccctccagatccacaccccatatcaa
gggtccatcgcgggggagagagagcttctcaacaaagcccgcgcagaactcctcaaagcg
ggaagagaagacattgccatctggcgagccgtatccatgacagcgccggaaggtcccgat
attgctgtggcactcatggatgacgtagatatgatccttctcgacgccggtgccggcggc
accggaaccccctttccttgggaaaagatccctcggggagtgacaccaaaggcaatcctg
gccgggggtcttaatcctgacaatcttcccgaagcattagtaagggggtgcgccggccta
gaccttaattccggcgtcgaatacccagccaacgccgggatctgggcgggattaaaagat
tcaggggcactacgccaagctttctccaccatccgagagtttcattattaa

DBGET integrated database retrieval system