KEGG   Corynebacterium ulcerans 809: CULC809_02173Help
Entry
CULC809_02173     CDS       T01880                                 

Gene name
trpC1
Definition
Indole-3-glycerol phosphate synthase (EC:5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cuc01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cuc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2474099..2475589
Genome map
AA seq 496 aa AA seqDB search
MHNNATSMPTVLEEIVHTRRSHLQEIRARIAHVDPLRLPRSTKSLFQALGGSASGGVAPR
RQAHSDTSTRAPHFIMECKSASPSLGDIRADYSPGDIARIYSRYASAISVLCEPDKFNGD
YDHLATVAASTHLPVLCKDFIINPVQVHAARYFGADAILLMLSVLDDATYISLSHEAERL
GLDVLTEVINEEEVKRAIRLGAKIFGVNHRNLHDLSIDLSRSSQLETLVPDTAILVSESG
IQTNETVRQLAGHSDAFLVGSQLTGCIDVDSAARSLVFGTNKVCGLTTASGAQTARAVGA
THGGLIFEDSSPRNVSRETAQKIIAAEPHLHYVAVSRRTQDWAEMLLPGIKTLQIHTPYQ
GSIAGERELLNKARAELLKAGREDIAIWRAVSMTAPEGPDIAVALMDDVDMILLDAGAGG
TGTPFPWEKIPRGVTPKAILAGGLNPDNLPEALVRGCAGLDLNSGVEYPANAGIWAGLKD
SGALRQAFSTIREFHY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcacaataatgcaacgtccatgcccacagtcttagaagaaattgttcacacccgccga
tcacatcttcaagagattcgtgcccgcattgcacatgtagatcctctccggttgccgcgg
tccacaaaatctctttttcaggcactcggaggttccgcgagtgggggagtggcgccgcgt
cgtcaagcacattctgacacctctacacgggcgccgcacttcattatggagtgcaaatcc
gcatcaccgtcattaggggacatccgagctgattattccccaggagacattgcacggatt
tactctcgctacgcttccgcgatttccgttctttgcgagcccgacaaatttaacggcgat
tacgatcacctggccaccgttgcagcttccacgcatctgccggttctatgcaaggacttc
atcatcaatcccgtgcaggtgcacgctgcacgctactttggcgcggatgcgatcctactc
atgctgagcgtgcttgacgacgccacctacatctcactttcccatgaagccgaacgcctc
ggcctagacgtcctcaccgaagtaatcaacgaggaggaggtaaagagagctattcgcctt
ggcgcaaagatttttggtgtcaatcaccgcaacctacacgacctcagtatcgacctttcc
cgttcctcacaactagaaaccctcgttccggacaccgctatactcgtgtcagaatccggc
atccaaacaaacgagactgtccgccagttggcaggccattccgacgccttccttgtcggc
tcacaactcaccggctgcatcgacgttgactccgccgcacgttcactcgttttcgggacc
aacaaggtgtgtggactcaccaccgcttccggcgcccaaactgcgcgcgcagtcggcgca
acgcatgggggattgatatttgaagactccagccctcgcaatgtttcacgtgaaactgcc
caaaaaatcattgcggcagagccacatctacactacgttgcggtgagtagacgcactcaa
gactgggcggaaatgctccttccgggtattaaaaccctccagatccacaccccatatcaa
gggtccatcgcgggggagagagagcttctcaacaaagcccgcgcagaactcctcaaagcg
ggaagagaagacattgccatctggcgagccgtatccatgacagcgccggaaggtcccgat
attgctgtggcactcatggatgacgtagatatgatccttctcgacgccggtgccggcggc
accggaaccccctttccttgggaaaagatccctcggggagtgacaccaaaggcaatcctg
gccgggggtcttaatcctgacaatcttcccgaagcattagtaagggggtgcgccggccta
gaccttaattccggcgtcgaatacccagccaacgccgggatctgggcgggattaaaagat
tcaggggcactacgccaagctttctccaccatccgagagtttcattattaa

DBGET integrated database retrieval system