KEGG   Corynebacterium ulcerans 809: CULC809_02176Help
Entry
CULC809_02176     CDS       T01880                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CULC809_02176 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CULC809_02176 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CULC809_02176 (trpA)
Enzymes [BR:cuc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CULC809_02176 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2477266..2478105
Genome map
AA seq 279 aa AA seqDB search
MNRYHNLFTRLEQSNEGAFVPFIMLGDPSPEASLAIIRTAVKAGADALEIGVPFSDPVAD
GPTIQRSHLRALDNGATVDSSLSLIAQIRSEFPDLPIGLLIYGNVPFTRGLDTFYQEFAT
AGADSILLPDVPVREGAPFITAAQQAGIAPIFIAPAKASEDTLRDVAAHSEGYIYAISRD
GVTGTERESSTSGLSDVVANITAFGGAPTLLGFGISTPQHVRDAMAAGARGVITGSAITA
IIERHCVGTHPQPATIDDMPALQSEISAFIAEMKEATRK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttaccacaaccttttcacccgactagagcaatccaatgaaggagcctttgtt
cctttcatcatgctcggcgacccttctcccgaagcatcacttgcaatcattcgtaccgct
gtcaaagccggcgcagatgcacttgagattggcgttcccttctcagacccggtggccgac
ggcccaaccatccaacgatctcatctccgcgccttggataatggagcaaccgtcgattcc
tctttgtcgctcattgctcagattcgttcagaatttccagacctgcccatcggcctcctg
atctacggcaacgtccccttcacccgtggactagataccttctatcaagaattcgccacc
gccggcgccgattctattttgcttcccgacgtcccagtacgggagggggcacctttcatc
acagcagcacaacaggcagggatcgcacctattttcattgcacccgcaaaggcatcggag
gataccctccgagacgtggcagcacattctgaaggctacatctacgcaatttctcgcgat
ggggtcaccggcacagaacgggaatcctccactagcggactcagtgacgtagtagcaaac
atcacggcattcggcggtgcccctacgcttctcgggttcggaatttccactccccaacac
gttcgcgacgcgatggcggccggggcaaggggagtaatcaccggatccgccatcacagca
atcattgaacgccactgtgttggtacacaccctcagcccgcaacaatcgatgacatgccc
gcgttgcaatcggaaatttccgcttttatcgctgagatgaaagaagcaacccgcaagtaa

DBGET integrated database retrieval system