KEGG   Corynebacterium ulcerans 0102: CULC0102_0137Help
Entry
CULC0102_0137     CDS       T02171                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cue00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(140946..142472)
Genome map
AA seq 508 aa AA seqDB search
MYIAAIDQGTTSTRCIIFDHDGNQVSVGQYEHEQIFPQKGWVEHDAIEIWDNTRRAVGTA
LADSDLSAKDIAALGITNQRETTVVWDKKTGEPVYNAIVWQDTRTTTICKELAGDEGADR
WYRKTGLLINSYPAGPKIKWILDNVDGARERAEAGELLFGTIDTWLLWNLTGGADGDDGT
PALHATDVTNASRTLLMDIEKLEWDKDLCDAMGIPMDMLPEIRPSVGDFHQVRERGSLSG
VPIRSMLGDQQAAMFGQGCFRPGEAKNTYGTGLFLLLNTGTTPKWSENGLLTTVCFQIEG
QKPVYALEGSVAVGGSLVQWLRDNLMLVPNSPMIENMARSVEDNGGVYIVPAFSGLFAPY
WRQDARGVIVGLTRFVNRNHLARAVLEATAYQTRDVADAMVADSGVELTELRVDGGMTYN
ELLMQFQADILGVPVTRPKNVETTATGAAFAAGYSVGYWENLEFLTQQKGDLHVWKPKME
QEKVDELYHDWKRAVKRSLNWEENVDEV
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtacatagcagccatcgatcaaggcactacttcaacccgctgcatcatttttgaccac
gacggcaaccaagtctccgtcggtcaatacgaacatgagcaaatcttcccacaaaaaggc
tgggtggagcacgatgccatcgaaatctgggacaatacccgccgcgcagtaggcaccgcc
ctggccgacagtgatctctccgccaaggacatagccgccttaggcattaccaaccagcgc
gaaaccacagtagtttgggacaaaaagaccggcgagcccgtatacaacgccatcgtgtgg
caggacactcgcaccactacaatctgcaaagagctcgctggcgacgaaggcgccgaccgc
tggtaccgcaagaccggcctcctcatcaattcctatcccgccggacccaaaatcaaatgg
atcctagataacgtcgacggcgcccgcgaacgcgcagaagcaggcgaactgctctttggc
accatcgacacatggctcctgtggaatctcaccggtggagctgacggcgatgacggaacg
ccagcattgcacgcaaccgacgtcaccaatgcttcccgaaccctcctcatggacatcgaa
aaacttgagtgggacaaagacctctgcgacgccatgggcatccccatggacatgctccct
gagatacgcccctcggtcggcgatttccatcaggtccgtgaacgcggatctctctccggg
gttcccatccgttcgatgcttggcgaccagcaagccgccatgttcggccaaggttgcttc
cgcccgggcgaagcaaaaaacacttacggcacaggcctcttcttgcttctcaacacagga
accactcccaagtggtcagaaaacggcctgctcaccacggtttgtttccaaatcgaaggc
caaaaaccagtctacgcactggaaggttcggtcgcagtcggaggatcgctagtccagtgg
ctgcgcgacaacctcatgcttgtccccaactctcccatgatcgaaaacatggcacgcagc
gttgaagacaatggcggcgtttatatcgtcccagccttctccggacttttcgccccatac
tggcggcaagacgcccgcggagtcatcgtcggacttacccgctttgttaaccgcaatcac
ctagcccgcgctgttttggaagctacggcgtaccagacccgcgatgttgcagacgccatg
gtcgcagactctggtgtggagctcactgagcttcgtgtcgatggcggcatgacctacaac
gaactcctgatgcagttccaggcagacattctcggtgttccagttacccgccctaaaaat
gtggaaactacagctactggagcagctttcgccgctggttattctgtgggttattgggag
aatcttgagttcctcacccaacaaaaaggcgatttgcacgtctggaagcccaagatggag
caggaaaaggtcgacgagctctaccacgattggaagcgcgcagtgaagcgttccctgaac
tgggaagaaaacgtagacgaggtctag

DBGET integrated database retrieval system