KEGG   Corynebacterium ulcerans 0102: CULC0102_0213Help
Entry
CULC0102_0213     CDS       T02171                                 

Gene name
tox
Definition
diphtheria toxin
Orthology
K00776  
NAD-diphthamide ADP-ribosyltransferase [EC:2.4.2.36]
Organism
cue  Corynebacterium ulcerans 0102
Brite
Enzymes [BR:cue01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.36  NAD+---diphthamide ADP-ribosyltransferase
     CULC0102_0213 (tox)
Bacterial toxins [BR:cue02042]
 Type III toxins: Intracellular toxins
  ADP-ribosyltransferase
   Diphtheria toxin (DT)
    CULC0102_0213 (tox)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
211802..213484
Genome map
AA seq 560 aa AA seqDB search
MNRKLFASILIGALLGIGAPPSAHAGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGI
QKPKSGAQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKILALK
VDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQ
AKELSVELEINFETRGKRGQDAMYEYMAQSCAGNRVRRSVGSSLSCINLDWDAIRDKTKT
KIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGVNSVFAG
ANYASWAVNVAQVVDSKTADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIAL
SSLMVAQAIPLVGELVDLGFAAYNFVESIINLFQVVHNSYNRPAYSPGHKTQPFVHGGYA
ASWNTVEDSIIKTGFQGESGHDIKITAENTPLPIAGVLLPTIPGKLDVNKSKTHISVNGR
KIRMRCRAIDDATTFCRPKTPVYVGNGVHANLHVAFHRSSSEKIHSDETPLSSIDVLGYQ
KTVDHTKVNSKLSLFAEVKS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagaaaactgtttgcgtcaatcttgataggggcgctactggggataggggcccca
ccttcagcccatgcaggcgctgatgatgttgttgattcttctaaatcttttgtgatggaa
aacttttcttcgtatcacgggactaagcctgggtatgtagattccattcaaaaaggtata
caaaagccaaaatctggtgcacaaggaaattatgacgatgattggaaaggattttatagt
accgacaataaatacgacgctgcgggatactctgtagataatgaaaacccgctgtctgga
aaggctggaggcgtggtcaaagtgacgtatccaggactgacaaagattctcgccctaaag
gtggataatgccgaaactattaagaaagagttaggtctaagtctcactgaaccgctgatg
gagcaagtcggaacggaagagtttatcaaaaggttcggtgatggtgcttcgcgtgtagtg
ctcagccttcccttcgctgaggggagttctagtgttgaatatattaataactgggaacag
gcgaaagagttaagcgtagaacttgagattaattttgaaacccgtggaaaacgtggccaa
gatgcgatgtatgagtatatggctcaatcgtgtgcgggaaatcgtgtcaggcgatcagtg
ggtagctcattgtcatgcataaatcttgattgggatgccataagggataaaactaagaca
aagatagagtctttgaaagagcatggccctatcaaaaataaaatgagcgaaagtcccaat
aaaacagtctctgaggaaaaggctaaacaatatctagaagaatttcatcaaacggcatta
gagcatcctgaattgtcagaacttaaaaccgttactggggtcaattctgtatttgctggg
gctaactatgcgtcgtgggcggtaaacgttgcgcaagttgtcgatagtaaaacagctgat
aatttagaaaagacaactgctgctctttcgatacttcctggtatcggtagcgtaatgggt
attgcagacggtgccgttcaccacaatacggaagagatagtggcacaatcgatagcttta
tcgtctttaatggttgctcaagctataccattggtaggagagctagttgatcttggtttt
gctgcatataattttgtagagagtattatcaatttatttcaagtagttcataattcgtat
aatcgtcccgcgtactctccggggcataaaacgcaaccatttgttcatggcggatatgct
gccagttggaacactgttgaagattcgataatcaaaactggttttcaaggcgagagcggg
cacgacataaaaattactgctgaaaataccccgcttccaatcgcgggtgtcctactaccg
actattcctggaaagctggacgttaataagtccaagactcatatttccgtaaatggtcga
aaaataaggatgcgatgcagagctatagatgatgctacaaccttttgccgccctaaaacc
cctgtttatgttggtaatggggtgcatgcgaatcttcatgtggcatttcatagaagtagc
tctgagaaaattcattctgatgaaactccgttgagctccatagacgtgcttgggtaccag
aaaacagtggatcacaccaaagtgaattctaagctatcgctatttgctgaagtcaaaagc
tga

DBGET integrated database retrieval system