KEGG   Corynebacterium ulcerans 0102: CULC0102_0235Help
Entry
CULC0102_0235     CDS       T02171                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cue  Corynebacterium ulcerans 0102
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cue00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CULC0102_0235 (recR)
DNA repair and recombination proteins [BR:cue03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CULC0102_0235 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
235660..236316
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDLIDELSRLPGVGPKSAQRIAFHLLHVEPADIARLQDALGAVRDGVTFCRICC
NISRESVCRICADSGRDRGMICVVEEPKDIQVIERTGEYNGRYHVLGGALDPLANIGPRE
LNISTLLQRIGGVLPDRELADSTPEAPLYDATPTVTEVILATDPNTEGEATASYLARLLR
DFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggaccgcttcaggaccttattgatgagctttcacggctccccggcgtgggc
cctaaatctgcgcaacgcatcgcttttcacttgctccacgtggagcccgctgacattgcg
aggcttcaggacgctctcggggccgtccgagacggcgtaaccttttgtcgtatttgctgc
aatatctcgcgtgaatcggtgtgccgtatctgcgcggattctggccgtgaccgcggaatg
atctgtgtggtggaggaacccaaagatattcaggtcattgagcggacaggtgaatataat
ggccgttaccatgtgctgggcggtgcactagatccactggccaatattggcccccgtgaa
ctgaacatttccacgttgttgcagcgcatcggaggcgtgcttccggatcgggagctggcc
gattctacgcctgaggcaccgctttacgacgccaccccaacggtgacagaggtaattctt
gccaccgaccccaatactgagggcgaggcgacggcatcgtatcttgcgcgtctgctccgc
gatttccccgacttggtggtttctcgtcttgcttctggcatgcctttgggcggggacctg
gagtttgtcgatgaactgacgttgtcccgcgccctgagcggtcgattgacgatttaa

DBGET integrated database retrieval system